KEGG   Dickeya chrysanthemi: Dd1591_3176Help
Entry
Dd1591_3176       CDS       T00930                                 

Definition
(GenBank) putative RNA 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
dze  Dickeya chrysanthemi
Brite
KEGG Orthology (KO) [BR:dze00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:dze03009]
    Dd1591_3176
Enzymes [BR:dze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     Dd1591_3176
Ribosome biogenesis [BR:dze03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Dd1591_3176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ Spt5-NGN Adeno_GP19K MIT_C
Motif
Other DBs
NCBI-ProteinID: ACT07998
UniProt: C6CEU3
Position
complement(3618747..3619847)
Genome map
AA seq 366 aa AA seqDB search
MNKVILYCRPGFEKECAAEITDKAARYNVYGFVRVKDNSGYVVFECYQHEDADRLIKELP
FQELVFARQMMVCGELLRDLPPEDRITPIVGMLTGVLERAGELRVEVPDTNESKELMKFC
RKFTVPLRAALRENRILLAQEKASRPVIHVLFIAPGCCYVGYSYSNNNSPFYMGIPRLKF
PADAPSRSTLKLEEAFHVFVPADEWDERLGSGMFAVDLGACPGGWTYQLVKRSMMVHAVD
NGMMAPSLMDTGQVIHHQADGFRFEPPRNNIYWLVCDMVEKPAKVTNRMADWLVNGWCRE
VIFNLKLPMKKRYEEVTQNLALLAQRLEENGINFEIHAKHLYHDREEITVHARRIWGAIP
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtgattttgtactgccgcccgggatttgagaaagagtgcgcggcggaaatt
accgacaaagcggcgcgttataacgtttatggttttgtgcgggtaaaagataacagcggg
tatgtggtgtttgaatgctatcagcatgaagacgccgatcggctgattaaagagttgccg
tttcaggaactggtgttcgcccgtcagatgatggtctgcggtgagttgctgcgcgatttg
ccgccggaggatcgcatcacgcctatcgtcgggatgctgaccggggtgctggagcgcgct
ggggaactgcgggttgaagtgcccgataccaatgaaagcaaagagttgatgaagttttgc
cgcaagtttacggtaccgctgcgcgctgcattgcgggaaaaccgtattctgctggcgcag
gagaaagccagccgtccggtcatccatgtgctgtttatcgcgcccggttgctgttacgtc
ggctattcctacagcaataacaactcaccgttctacatggggattccacggctgaagttc
cccgcggatgccccaagccgttcgacgctgaagctggaagaagccttccatgtgtttgta
ccggcggacgagtgggacgagcgcctcggcagcggcatgtttgcggtggatttgggggct
tgccccggcggctggacctaccaactggtaaaacgcagtatgatggttcacgccgtcgac
aacggtatgatggcgccgagcctgatggataccggccaggttatccaccatcaggcggat
ggtttccgctttgaaccgccgcgcaataatatctactggctggtgtgcgatatggtagaa
aaaccggccaaagtcaccaaccgtatggcggactggctggtcaacggctggtgtcgtgaa
gtgatcttcaacctcaagctgccgatgaaaaagcgctatgaggaagtgactcagaatctg
gctttattggcgcagcggctggaagaaaacggcattaacttcgagattcacgccaagcat
ctctatcacgatcgcgaagagattaccgttcatgcccgacgcatctggggcgcgattcct
ggtcgtcgcgacgaacgctaa

DBGET integrated database retrieval system