KEGG   Dickeya chrysanthemi: Dd1591_3735Help
Entry
Dd1591_3735       CDS       T00930                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00240  Pyrimidine metabolism
dze00250  Alanine, aspartate and glutamate metabolism
dze01100  Metabolic pathways
Module
dze_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dd1591_3735
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dd1591_3735
Enzymes [BR:dze01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Dd1591_3735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACT08537
UniProt: C6CM90
Position
4224915..4225850
Genome map
AA seq 311 aa AA seqDB search
MVNPLYKRHIISINDLSRDDLELTLKVAASLKAHPQPELLKHKVIASCFFEASTRTRLSF
ETAIHRLGASVVGFADSNNTSLGKKGETLADTISVISNYVDAIVMRHPQEGAARLATEFS
GGVPVFNAGDGANQHPSQTLLDLFTIQETQGRLNNINIAMVGDLKYGRTVHSLTQALAKF
DGNRFYFISPDALAMPDYILNMLQEKNIPYSLHTSIEEVVPQLDILYMTRVQKERLDPSE
YINIKSQFILRAADLGSARDNLKVLHPLPRIDEITTDVDSTPYAYYFQQAGNGIYARQAL
LALVLNSELVL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatccgctatataaaagacacatcatctcaatcaacgatctcagccgcgacgat
ctggaactgacgctcaaggtggcggcgagtctgaaagcgcatccgcagccggaactgctg
aagcacaaagtgattgccagctgtttctttgaagcctccacccggacccgcctgtcgttt
gaaaccgccattcaccggctgggcgcgtcggtggtcggttttgccgacagcaacaacact
tcgctcggtaaaaaaggcgaaacgctggccgataccatttcggtcatcagcaactatgtg
gacgcgattgtgatgcgccacccgcaggaaggcgcggcacggctggcgaccgagttctcc
ggcggcgtgccggtgttcaacgccggcgacggcgccaaccagcacccttcccaaacgctg
ctggatctgttcaccattcaggaaacccagggccgtctgaacaacatcaatatcgccatg
gtcggcgacctgaaatacggccgcaccgtccattctctgacccaggcgctggccaagttc
gacggcaaccgcttctacttcatctccccggacgcactggcgatgccggattacatcctc
aacatgctgcaagagaaaaatattccctacagcctgcataccagcattgaggaagtggtg
ccgcagttggatattctgtacatgacccgcgtacagaaagagcggctggacccgtcggag
tacatcaatatcaaatcgcagtttatcctgcgcgccgccgacctcggcagcgcccgcgac
aatctgaaagtgctgcatccactgccgcgtatcgatgaaatcaccaccgacgtggacagc
acgccctacgcctactacttccagcaggcaggcaacggtatttacgcacgccaggctctg
ctggcgttggttttgaacagcgaactggttctgtga

DBGET integrated database retrieval system