KEGG   Dickeya chrysanthemi: Dd1591_4019Help
Entry
Dd1591_4019       CDS       T00930                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dze  Dickeya chrysanthemi
Pathway
dze00010  Glycolysis / Gluconeogenesis
dze00030  Pentose phosphate pathway
dze00051  Fructose and mannose metabolism
dze00052  Galactose metabolism
dze00680  Methane metabolism
dze01100  Metabolic pathways
dze01110  Biosynthesis of secondary metabolites
dze01120  Microbial metabolism in diverse environments
dze01130  Biosynthesis of antibiotics
dze01200  Carbon metabolism
dze01230  Biosynthesis of amino acids
dze03018  RNA degradation
Module
dze_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dze00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd1591_4019
   00030 Pentose phosphate pathway
    Dd1591_4019
   00051 Fructose and mannose metabolism
    Dd1591_4019
   00052 Galactose metabolism
    Dd1591_4019
  Energy metabolism
   00680 Methane metabolism
    Dd1591_4019
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dd1591_4019
Enzymes [BR:dze01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dd1591_4019
Protein phosphatases and associated proteins [BR:dze01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dd1591_4019
Messenger RNA biogenesis [BR:dze03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Dd1591_4019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACT08817
UniProt: C6CP75
Position
complement(4538056..4539018)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALAENLDVYGIYDGYLGLYEDRMVQLDRYSVSD
VINRGGTFLGSARFPAFREEAVRQVCVENMKKRDLDALVVIGGDGSYMGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEVDFKKEDLVEEIKAGIAKGKKHAIVAITELVCDVDELAHYIEAETE
RETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYGGRCVGIQNEKLVHHDIIDA
IENMKRPFKGDWLNTAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggagtactgacgagcggtggcgatgcgccggggatgaatgcggcc
attcgtggtgtggtgcgtgccgcgttagcggaaaacctggacgtatacggcatttatgac
ggctatctgggtttgtacgaagaccgcatggtgcagttggaccgctacagcgtatcggat
gtgatcaaccgcggcggcactttcctcgggtctgcccgcttcccggcgtttcgcgaagaa
gcggtgcgccaggtgtgcgtggaaaacatgaaaaagcgtgatctggacgcgctggtggtt
atcggcggcgacggttcctacatgggggccaagcgcttgaccgaaatgggtttcccctgc
atcggtttgccgggcaccattgataacgatgtggcgggcaccgattacaccatcggttat
ttcaccgcgttggaaaccgtagtggaagcgattgaccgcctgcgcgatacctcctcttcc
catcagcgtatttccattgtggaagtgatggggcgtcattgcggcgatctgacgctggcc
gcggcgatcgccgggggatgtgagttcatcgtgttgccggaagtcgatttcaaaaaagaa
gacctggtggaagagatcaaagccggtatcgccaaagggaaaaaacacgccattgtggcg
attaccgagctggtgtgcgacgtggatgagctggcgcactatattgaagcggaaaccgaa
cgcgaaacccgcgccaccgtgctggggcacatccagcgcggcggttcgccggtagcgtat
gaccgcattcttgcctcccgcatgggcgcgtattccatcgaactgttgcagcagggctac
ggcggccgttgcgtcgggatccagaatgaaaaactggtccaccatgatattatcgacgcc
atcgagaacatgaagcgtccgttcaaaggcgactggctgaataccgccaagaagctgttc
tga

DBGET integrated database retrieval system