KEGG   Durio zibethinus (durian): 111276153Help
Entry
111276153         CDS       T05242                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1
Organism
dzi  Durio zibethinus (durian)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase DUF3403 APH
Motif
Other DBs
NCBI-GeneID: 111276153
NCBI-ProteinID: XP_022717690
Position
Unknown
AA seq 370 aa AA seqDB search
MMPSRPTKKMKHEPLEGFLKCIGGSSSNNQKQKEDPELPLFDKGTIAHATKNFCNTNKLG
EGGFGSVCKDLLRDGQEIAVKRLSENSKQGLNEFKNEVLLIAKLQHRNLVKLLGSCIEGD
EKMLIYEFMPNKSLNFFLFDQAQSLSLDWPKRYNIINGIARGLLYLHQDSRQRIIHRDLK
AGNILQDSQLNPKISAFGLARSFGENETKEKTKKVVGTYGYMSREYAIDGLYSIKSDVFS
FGVLVLEIVSGQRNRGFTHPDHHHNLLGHAWKLYAEGKSVELIAAPIRDNIYLSEVLRSI
HIGLLCVQRSPEDRPSMSNVVLMLGGESPLPQPKQPGFFSERDLVEASASSSYQKPCSYD
EFTITLMEGR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctagtaggccaaccaagaaaatgaagcatgaaccacttgaaggatttcttaaa
tgcattggtggaagcagttcaaataatcaaaagcagaaggaagatccagaattaccattg
tttgacaaggggacaattgcccatgcaacaaaaaatttttgcaatacgaacaagcttggg
gaaggtggttttggatccgtctgtaaggatctgttaagggatggacaagaaatagcagta
aagaggctatcagagaattcgaaacaaggtcttaatgagttcaaaaatgaagtactactt
attgcaaagctgcagcaccgaaatttagtgaagcttcttggtagctgtattgaaggagat
gaaaagatgttgatctatgaatttatgcctaacaaaagcttgaatttctttctttttgat
caagctcaaagcttgtccctggattggcctaagcgctacaacatcatcaatggaattgct
cgtggactcctttatcttcatcaagattccaggcaaagaataattcatagagatctgaaa
gctggtaatatattacaagacagtcaactgaacccaaaaatttcagcctttggccttgct
agaagttttggagaaaatgaaaccaaagaaaagaccaagaaagtggtgggaacatatggt
tacatgtctcgagagtatgcaatcgatgggctctactcaattaaatctgatgtttttagc
tttggtgtgttggtgctagagattgttagtggccaaagaaacagaggattcacacatcca
gatcaccaccataaccttcttgggcatgcctggaagttatatgctgaagggaagtccgtg
gaactgattgctgcaccaattagggacaacatctatctatctgaagttctgagatcaatc
catataggtctattatgcgtgcaacggagtccagaagataggccaagcatgtcaaatgtg
gtcctgatgcttggtggtgaaagtcctttgcctcagcctaaacaaccaggttttttcagt
gaaagggatctagttgaagctagtgcctcatcaagctatcagaaaccatgttcatatgac
gaattcaccattacactaatggaaggaagataa

DBGET integrated database retrieval system