KEGG   Durio zibethinus (durian): 111276313Help
Entry
111276313         CDS       T05242                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
dzi  Durio zibethinus (durian)
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dzi01001]
    111276313
Enzymes [BR:dzi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111276313
Protein kinases [BR:dzi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111276313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Kinase-like Kdo YukC
Motif
Other DBs
NCBI-GeneID: 111276313
NCBI-ProteinID: XP_022717806
Position
Unknown
AA seq 318 aa AA seqDB search
MPIRYSYSEIRKMTENFKHKLGQGGYGSVFKGKLRNGQLVAIKFLTKLKADGQDFISEVA
TIGRIHHVNVVRLIGFCVEGSKQALVYDFMINGSLDKIIFSTDNNTLNWQRTFEIALGVA
RGIEYLHRGCEMQILHFDIKPHNILLDENFTPKVSDFGLAKLYSVDDSIVSLTAARGTIG
YIAPEFLYKDIGGISYKADVYSFGMMLIEMVGRRKNLDPFAEHSSQIYLPSWIYDQLDQG
DDMELEDVTESDKKILRKMLIVAFWCTQMKHTNRPSMSKVLKMLESEVEPPEMPPKPFLL
SLETATKDGENSGDNHIT
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcctataagatattcttattctgaaataaggaaaatgacagaaaatttcaagcataaa
ttaggtcaaggaggttatggctctgtgtttaaaggaaaacttcgaaacggccaacttgtt
gcaataaaattcttaaccaaattaaaagctgatggccaagatttcattagtgaagttgca
actattggaaggatacatcatgttaatgttgtacggcttattggattttgtgtggaggga
tcaaaacaggcacttgtatatgatttcatgataaatggatccttagataaaatcatattt
tcaacagacaataacactttgaattggcaaagaacgtttgagattgctttgggagtggct
cgaggtattgaatatttgcatagaggttgtgaaatgcaaattctacattttgatatcaag
ccacataacattcttctggatgagaactttactccaaaagtttcagattttggcctcgca
aaattgtattcagtggatgatagcatcgtctctctcacagcagcacgaggtacaatagga
tacattgctcctgagttcctttacaaagacattggaggcatttcatataaagcagatgtt
tatagttttggaatgatgttaattgaaatggttggaaggaggaagaacttggatccattt
gcagaacattccagtcaaatttatcttccatcatggatttatgatcaacttgatcaagga
gatgacatggagcttgaagatgtgacagaaagtgacaagaagattctgagaaaaatgttg
atagtcgccttttggtgcacacagatgaagcacacaaatcgtccttcaatgagcaaagtg
ttgaagatgctggaaagtgaagttgaaccccctgaaatgcctccaaagccttttctactt
tctctcgaaacggcaactaaagatggtgagaattctggggacaaccacatcacttaa

DBGET integrated database retrieval system