KEGG   Durio zibethinus (durian): 111276334Help
Entry
111276334         CDS       T05242                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
Organism
dzi  Durio zibethinus (durian)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind Pkinase_fungal APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 111276334
NCBI-ProteinID: XP_022717815
Position
Unknown
AA seq 666 aa AA seqDB search
MVKPKLSVFGRMVVLALFLYPESCIARVGNQDCGSTFCGNLNISYPFRLKSQPWKCGRHW
LELECENDNNLTTLVRGYEKFYVKEIFYENSTLRVVDASLGRDDCSLPLSRFYHDSSICD
KPYLPEWYFDEYRDHYSVMYLVNCTTPVKSSLYVDASRCTNSYSLHPPSYFYFLDRETSS
LDFNQSCTVIAEVPIMLQNITGLSTFGIYERLLMGFELFWWSNPLGRDYNEICSNKLSIN
QILAKIRDALIDYFNSFAYYIIHRPLVSAFNGFPPETDRTYIMCLGITGGIALARMLLGI
SILIAVVTYKLRRRHLSADDTIEEFLQSQNNFIPIRYSYYEIKRITSGFKDKLGEGGFGS
VFKGKLRSNHLVAVKLLGKSKANGQDFINEVATIGRIHHVNVAKLIGFCVEGSKQALVYD
FMPNGSLDKMIFSGENMNSLSWQKMLDIVIGVARGIDYLHRGCDMQILHFDIKPHNILLD
ENFNPKVSDFGLAKLYSVDDSIVSLTAARGTLGYIAPELVYKNIGGISYKADVYSFGMLL
MEIVGRRKNLNAFAEQSSQIYFPSWVYDRFEQGEEIELGDVTDSEKTIMRKMLVVAFWCI
QMRPSNRPSMSKVLEMLETDTELLEMPPRPFQFPFDASTKDHGGDKPIDEPTTSLDATNE
ISLNIA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaccaaaactttcagtgtttggccgcatggtcgtccttgctttatttctttac
cctgagtcttgcatcgctcgagtcggaaaccaggactgcggctctactttctgtggaaac
cttaacatcagttacccttttcgattaaaaagccagccttggaagtgtggtcgtcattgg
cttgaactggaatgcgagaatgataataacctcacgactttggttaggggatatgaaaaa
ttctatgtgaaagagatcttttacgagaattctacactacgagtcgtcgatgcaagtctg
ggtagggatgattgctcccttccactcagtcggttctatcatgattcttcaatttgtgat
aagccataccttcctgaatggtattttgacgaatatagggatcattatagcgttatgtat
cttgtaaattgcacaacaccagtgaaatcttctctctatgtggatgcctctcgttgcacc
aatagctattccctgcatccaccttcctacttttattttttagatcgagaaaccagctcg
ctagatttcaatcaatcttgcacagtcatagccgaggttccaatcatgctccagaatatc
acaggcctgtctactttcggtatctacgaaaggctattaatggggtttgaattgttttgg
tggtctaatccattgggacgagattacaacgagatctgctcaaacaaactttcaattaac
caaatattagccaagattcgggatgcgttgatagactactttaacagttttgcatattac
attatccatcgccccctggtatcagctttcaatggttttccacctgagactgacagaaca
tatattatgtgtcttggaataacaggaggaattgccttagcaagaatgttgctggggata
tctatcttgattgcggttgttacatacaaattacgaagaaggcacttatctgcagatgat
acaattgaagagtttcttcaaagtcaaaataactttatacctatcagatattcttactat
gaaataaaaagaataactagtggcttcaaagataaattaggagaagggggttttggttca
gtgtttaaaggaaaacttcgtagcaaccatcttgtggcagtaaagttgttgggcaaatca
aaagctaatgggcaagatttcattaatgaagttgcaacaataggaaggatccatcacgtc
aatgttgcgaaacttattgggttttgtgtagagggttcaaagcaagctcttgtatatgac
ttcatgccaaatggttctttagataaaatgatattttctggagaaaatatgaacagttta
agctggcagaaaatgcttgacattgtgattggagttgctcgaggaattgactatttacat
cgaggatgtgacatgcaaattttacattttgatatcaagcctcataatattcttctagat
gagaatttcaacccaaaagtttctgattttggtctggcaaaattgtattcagtagatgat
agtattgtctctcttactgcagcacgaggtacactgggatatattgctcctgaattggtc
tacaaaaacattggaggcatctcatataaggctgatgtttatagttttgggatgctatta
atggaaattgtgggaagaaggaaaaatttgaatgcatttgcggaacaatcaagtcagata
tacttcccatcatgggtatatgatcgatttgagcaaggagaggaaatagaattgggagat
gttacggatagtgagaagacaattatgaggaagatgttagtagtagctttttggtgtata
caaatgaggccttctaatcgtccttcaatgtcaaaagtattggagatgctcgaaactgat
actgaattgctcgaaatgcctccaagaccttttcagtttccttttgatgcatcaactaag
gatcatggtggcgacaagccaattgatgagccaactacatcacttgatgctacgaatgaa
attagcttaaatatagcgtaa

DBGET integrated database retrieval system