KEGG   Durio zibethinus (durian): 111276426Help
Entry
111276426         CDS       T05242                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK11
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
dzi  Durio zibethinus (durian)
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dzi01001]
    111276426
   01009 Protein phosphatases and associated proteins [BR:dzi01009]
    111276426
Enzymes [BR:dzi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111276426
Protein kinases [BR:dzi01001]
 Serine/threonine kinases: Other
  Wnk family
   111276426
Protein phosphatases and associated proteins [BR:dzi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111276426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 111276426
NCBI-ProteinID: XP_022717892
Position
Unknown
AA seq 299 aa AA seqDB search
MMPSVNPDQSDKDSEPFVEIDPTGRYGRYTELLGSGAVKKVYRAFDQEEGIEVAWNQVKL
RNFSNDPTMIDRLYSEVRLLRSLTNKNIISLYNVWRDEEHSTLNFITEVCTSGNLREYRK
KHRQVSMKALKKWSKQILKGLDYLHTHEPCIIHRDLNCSNVFVNGNTGQVKIGDLGLAAI
VGKNHSAHSILGTPEFMAPELYEEHYTELVDIYSFGMCVLEMVTLEIPYSECDNVAKIYK
KVSSGVRPQALSKVRDPDVKAFIERCLAQPRARPSAADLLKDPFFYEVDDDENDDGVSS
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctagcgtcaatccagaccagtccgacaaggattccgagccctttgtcgagatc
gatccgacgggtcgttatggtcgttacactgagcttctaggatctggagcagtaaaaaag
gtttaccgagcatttgatcaagaagaaggcattgaagttgcatggaaccaagtcaaacta
agaaacttctccaacgatccaaccatgatcgataggctttattcggaggttcgtttatta
agatcattaaccaacaaaaacataatctcattgtacaatgtttggcgagacgaggaacat
agcacgttgaatttcataactgaagtgtgtacttctgggaatctgagggagtacaggaaa
aaacatagacaagtttcaatgaaggcattgaagaaatggtcaaagcagattttgaaaggc
ttggattatttgcatactcatgagccttgcattattcacagagatcttaattgcagcaat
gtttttgtcaatggaaacactggtcaggttaagattggtgatttgggattggctgccatt
gttgggaagaaccattcagcacattcaatccttgggacaccggaatttatggcaccggag
ttatatgaggaacattacacagaacttgttgatatatactcatttggcatgtgtgtgctt
gagatggtgaccttggaaattccctatagtgagtgtgacaatgtggccaaaatttacaag
aaagtttctagtggggtgaggcctcaagccttgagcaaggttagagatcccgatgtaaaa
gcattcattgagagatgccttgctcagcctagggcaagaccgtcagcggcggacctgctc
aaggatccatttttttatgaagttgatgatgatgaaaatgatgatggagtctcttcttga

DBGET integrated database retrieval system