KEGG   Durio zibethinus (durian): 111276565Help
Entry
111276565         CDS       T05242                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
Organism
dzi  Durio zibethinus (durian)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal YukC
Motif
Other DBs
NCBI-GeneID: 111276565
NCBI-ProteinID: XP_022718046
Position
Unknown
AA seq 318 aa AA seqDB search
MPIRYSYSEIKKMTQNFKHKLGQGGYGSVFKGKLRSGQLVAIQLLSKSKADGQDFIIEVA
TIGRIHHVNVVHLIGFCVEGSKQALVYDFMINGSLDKIIFSTDNNTLNWQRMFEIALGVA
QDIEYLHRGCEMQILHFDIKPHNILLDENFTPKVSDFGLAKLYSVDDSIISLTAARGTLG
YIAAELFYKNLGGISYKADVYSFGMMLIEMVGRRKNLDPFAEHSSQIYLPSWIYDQLDQG
DVMELEDVTESENKILRKMLIVAFWCTQMKPTNPPSISKVLEMLESEAELLEMPPKPFLL
SLDKATKDGENSGDNHIT
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcctataagatattcttattctgaaataaagaaaatgacacaaaatttcaagcataaa
ttaggtcaaggaggttatggttctgtgtttaaaggaaaacttcgaagtggtcaacttgtt
gcaatacaattgttaagcaaatcgaaagctgatggccaagatttcattattgaagttgca
actattggaaggatacatcatgttaatgtggtgcatcttattggattttgcgtggaggga
tcaaaacaggcacttgtatatgatttcatgataaatggatccttagataaaatcatattt
tcaacggacaataacactttgaattggcaaagaatgtttgagattgctttgggagtggct
caagatattgaatatttgcacagaggttgtgaaatgcaaattctacatttcgatatcaag
ccacataacattcttctggatgagaactttactccaaaagtttcagattttggcctcgca
aaattgtattcagtggatgatagcatcatctctctcacagcagcacgaggtacactagga
tacattgctgccgagttgttttacaaaaaccttggaggcatttcatataaagcagatgtt
tatagttttggaatgatgttaattgaaatggttggaaggaggaagaacttggatccattt
gcagaacattccagtcaaatttatcttccatcatggatttatgatcaacttgatcaagga
gatgtcatggagcttgaagatgtgacagaaagtgaaaacaaaattctgagaaaaatgttg
atagttgccttttggtgcacacagatgaagcccacaaatcctccttcaataagcaaagtg
ttggagatgctagaaagtgaagctgaactgcttgaaatgcctccaaagccttttctactt
tctctcgataaagcaactaaagatggtgagaattctggggacaaccacatcacttaa

DBGET integrated database retrieval system