KEGG   Durio zibethinus (durian): 111276583Help
Entry
111276583         CDS       T05242                                 

Definition
(RefSeq) rust resistance kinase Lr10-like
Organism
dzi  Durio zibethinus (durian)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 111276583
NCBI-ProteinID: XP_022718070
Position
Unknown
AA seq 661 aa AA seqDB search
MVKAQLSLFWLMALSFFLSFPDSCIAKLPIPKDCGSSYCGNVTVNFPFRLKSQLPECGYH
NLELECDNNNRTTFVFVGEKLYVQQISYENQTIRAMFMVDHERPSRDNCSLPRNIIRYLF
DYLYLNSTADLYVRLNYPHSYMYLVNCTTAMKSSLYVNASRCSNSYSHPPSYFYFLNENT
RSSNFNPSCIVIAKVPIMLKNITGLSTSDIYEQLLLGYELIWDYYNFHAWRDDSLIRQIL
PDLGYALKIYVDSFVHFLFKGPYVFYNDGDQTRLTYILCVGITGGIALARMLLGISILIA
VVTYKLRRRHLSADDTIEEFLQSQNNFIPIRYSYYEIKRITSGFKDKLGEGGYGSVFKGK
LRSNHLVAVKLLGKSKANGQDFISEVATIGRIHHVNIAKLIGFCVEGSKQALVYDFMANG
SLDKIIFSGENKISLSWQKMLDIVLGVARGIDYLHRGCDMQILHFDIKPHNILLDENFNP
KVSDFGLAKLYSVDDSIVSLTAARGTLGYIAPELVYKNIGGISYKADVYSFGMLLMEIVG
RRKNLNAFAEQSSQIYFPSWIYDRFEQGEEIELGDVTDNEKTILRKMLVVAFWCIQMKPP
SRPSMSKVLEMLETDTDLLEMPPRPFQFPFDASTKDHGGDNPIDEPTTSLDATNEISLNI
V
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagcacaactttcgttgttttggctcatggccctttcttttttcctatcattc
cctgattcttgcatcgctaaacttccaattcctaaagattgtggctcttcctactgtgga
aacgttaccgtcaatttccctttccgattaaaaagccagcttcccgagtgtggttaccat
aacctggaactggaatgcgacaacaacaatcgcaccacttttgtgtttgttggggagaaa
ttgtacgtccaacagatctcttatgaaaaccaaacaatacgagctatgtttatggtggat
catgagagaccgagcagagacaattgctctcttcctcgtaatattattagatatctattt
gattatttgtatttaaattcaacagccgacctatacgttcgtttaaattatcctcatagt
tacatgtatctagtaaattgcacaacagcaatgaaatcttccctatatgtcaatgcctct
cgttgctccaacagctattctcatccgccttcctacttctattttttaaatgaaaacacc
cggtcgtccaatttcaatccatcttgcatagtcatagccaaggttccaatcatgcttaag
aatattacaggtctgtctacttcggatatttatgaacagctattactgggctatgaactg
atatgggattactacaacttccacgcatggcgcgatgattcattaatccgacagatattg
ccagatttgggatatgccttgaaaatctatgtggacagctttgtgcatttcctttttaag
ggtccttatgtattttacaatgatggtgatcaaactagacttacatatattctttgtgtt
ggaataacaggaggaattgctttagcaagaatgttgctggggatatctattttgattgcg
gttgttacatacaaattacgaagaagacacttatctgctgatgataccattgaagagttt
cttcaaagtcaaaacaactttataccgattaggtattcttactatgaaataaaaagaata
actagtggtttcaaagataaattaggagaagggggttatggttcagtgtttaaaggaaaa
cttcgtagcaatcatcttgtggcagtaaagttgttaggcaaatcaaaagctaatggacaa
gatttcattagtgaagttgcaacaattgggaggattcatcatgtcaacattgcgaaactt
attgggttttgtgttgaggggtcaaagcaagctcttgtatatgatttcatggcaaatggt
tccttagataaaatcatattttctggagaaaataagatcagtttaagctggcagaaaatg
cttgatattgtgctaggagttgctcgaggaattgactatttacatcgaggatgtgacatg
caaattttacattttgatatcaagcctcataatattcttcttgatgagaatttcaacccc
aaagtttcagattttggtctggcaaaattgtattcagtagatgatagtattgtctctctt
actgcagcacgaggtacactgggatatatcgctcctgaattggtctacaaaaacattgga
ggcatctcatataaggctgatgtttatagttttgggatgctattaatggaaattgtggga
agaaggaaaaatttgaatgcgtttgctgaacaatcaagtcagatatacttcccatcatgg
atatatgatcgatttgagcaaggagaggaaatagaattgggagatgttacggataatgag
aagacaatcttgaggaagatgttagtagtagctttttggtgtatacaaatgaagcctcct
agtcgtccttcaatgtcaaaagtattggagatgctggaaactgatactgacttgcttgaa
atgcctccaagaccttttcagtttccttttgacgcatcaactaaggatcatggtggagac
aatccaattgatgagccaactacatcacttgatgctacgaatgaaattagcttaaatata
gtgtaa

DBGET integrated database retrieval system