KEGG   Durio zibethinus (durian): 111280188Help
Entry
111280188         CDS       T05242                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED6, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00906  Carotenoid biosynthesis
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
Module
dzi_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    111280188
Enzymes [BR:dzi01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     111280188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 111280188
NCBI-ProteinID: XP_022723113
Position
Unknown
AA seq 611 aa AA seqDB search
MQASLHFFTTITTTTTTTNSTTPNHEALLHAQYPLFTCKILVNPSKKTIPWNPLTRPPLE
VEPMVKPERVLVPPQGPNYPVHFNPFQKLAALALDKIETSVIMPLEKNHDLPKMVDPAVQ
MSGNFAPVQECPVQHGLEVVGQIPACLRGIYVRNGANPMFAPSGGHHLFDGDGMLHAVCL
GLGNRASYSCRYTRTSRLVQEAQLGRSMFPKPIGELHGHLGLARLGLFMARTGVGLVDGS
HGTGVANAGLVYFNGRLLAMSEDDLPYHVKINDDADLETIGRFNFDDQIDCPLIAHPKLD
PVTGELHTLSYNVLKKPYLKYFKFDKFGKKLSDLHVAIEQATMIHDFAITENFVVIPDHQ
MVFKLSEMIRGGSPVVYDKKKTSRFGILQQNDVDGSRIQWIDVPNCFCFHLWNAWEENSD
NGDKIIVVIGSCMNPPDSIFNDSKDLFRSELSEIRMNLRAGESTQRVIISGMNLEAGQVN
RQYQGRKTRFVYLAIAEPWPKCSGIAKVDLETGEVTKFMYGPWRFGGEPFFVPEKKQKFG
DNNSEAEAEAEAEDEGYIMGLMRDEKREISELVIVKALSMEQVAAIMLPTRVPYGFHGTF
VSQEELSRQVV
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctcacttcacttcttcaccaccatcaccaccaccaccaccacaaccaactca
acaaccccaaatcatgaagctctccttcatgctcagtatccattgtttacatgcaaaatt
cttgtcaatccttccaagaaaacaattccttggaatccgttaacaagaccacctcttgag
gttgaacctatggtcaagcctgaacgtgttttggttccaccacaaggaccaaactatcct
gttcactttaatccatttcaaaagctagcagcattagctttagacaaaattgagacctcg
gtgatcatgccactagaaaaaaatcatgacttgcctaaaatggttgatccggcggttcaa
atgtcaggtaactttgcaccggttcaagagtgtccggttcagcatgggttggaagtggtg
ggtcagattcctgcttgcctacgtggcatctatgtccgaaacggtgcaaatcctatgttt
gcaccctccggtggacaccatttgtttgacggtgatgggatgctccatgccgtttgcttg
ggccttgggaatagagctagctatagttgcaggtacactcgaacgagccggttggttcaa
gaagcccagttgggtcggtccatgtttcctaaaccaattggcgagttgcatgggcatttg
ggtttggctaggctcggtctgttcatggctcgaactggtgtaggcttggttgatggttca
catggcacgggtgtggcaaatgctggacttgtttacttcaatgggcgattattagccatg
tcggaagatgatcttccttatcatgttaaaatcaatgatgatgctgatcttgaaactatc
ggacggttcaattttgatgatcaaattgattgtccattgatcgctcatcccaaattagat
cctgttacaggtgagttgcacactctgagttacaatgttttaaagaaaccctacttgaaa
tatttcaagtttgataaattcggcaaaaagttaagtgatttacacgtggctatcgagcag
gcaacgatgattcatgactttgctataacagagaattttgtagtaatcccggatcaccaa
atggtattcaagttatccgaaatgatccggggagggtcacccgttgtatatgacaaaaag
aagacatctcggtttggaattttgcaacaaaatgatgttgatggatcgagaatccaatgg
attgacgtaccaaattgcttctgtttccatttatggaatgcatgggaagaaaattctgat
aatggtgataaaataatcgtcgttattggatcctgtatgaacccgccggactccattttc
aacgactctaaagacctgttccgaagtgagctatccgaaatcaggatgaacttaagagca
ggagagtcaacacaaagggttattatatcaggcatgaacttggaagcaggtcaagtgaac
cggcaatatcagggtcgaaagactcggttcgtgtacttggcgatagcagagccatggcca
aagtgttctggcattgctaaagttgatttagagacaggagaagtcaccaagttcatgtat
ggaccatggcgttttgggggtgagccattttttgtgcctgaaaagaagcagaaatttggg
gacaataatagtgaagctgaagctgaagctgaagctgaagatgaaggatatataatgggg
cttatgagagatgaaaagagggagatttcggagctggtaatagtgaaagctttgagcatg
gagcaagtggctgccataatgttgcctacaagggttccatacgggtttcatggcacgttt
gtcagccaagaagagctaagccgacaagtcgtctga

DBGET integrated database retrieval system