KEGG   Durio zibethinus (durian): 111282199Help
Entry
111282199         CDS       T05242                                 

Definition
(RefSeq) glutathione S-transferase U17-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00480  Glutathione metabolism
dzi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111282199
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dzi02000]
    111282199
Enzymes [BR:dzi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     111282199
Transporters [BR:dzi02000]
 Other transporters
  Pores ion channels [TC:1]
   111282199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4 Caudo_TAP
Motif
Other DBs
NCBI-GeneID: 111282199
NCBI-ProteinID: XP_022725927
Position
Unknown
AA seq 233 aa AA seqDB search
MAESDVKVLGSWSSPFMLRARIALHLKSVNYEYIEENLLESKSELLLKSNPVFKKVPVLI
HGDKSICESLIIVQYINEVWTSGPSILPSDAYERANSRFWAAYIDDKWFPALRRVLVAEA
EDTKKEAIAQVEEGLVLLEEAFRKFSKGKAFFGGDNIGYLDITIGCFLVWIEVIEKYNEI
KLLTEAKTPCLLEWVDSFSSHGAVKDVLPEADKLAEFGVKLRAKILKARATPN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagtgatgtgaaagttttgggttcatggtcaagtccatttatgttgagggcg
agaattgcccttcacctcaaatctgtaaactacgagtatattgaggaaaatttattggaa
tcaaaaagcgagctgcttctgaaatcgaaccctgttttcaagaaagtcccggtcctcatt
cacggtgataagtctatctgtgagtctctaatcattgtccaatatatcaatgaggtttgg
acatctggcccttccattcttccttctgatgcttatgaacgtgccaattctcgattttgg
gctgcctatattgacgacaagtggttccctgccttgagacgagtgttggttgctgaagca
gaggatactaaaaaggaagcaatagcgcaagtggaagaagggctggtgctgttggaggaa
gcattcagaaagttcagcaaagggaaagctttctttggtggggataatattgggtacctg
gacattacaatcggttgtttcttggtctggattgaagtcatagagaagtataatgagatc
aaactgcttactgaagccaagactccttgcttgctcgagtgggttgatagcttctcctct
catggggctgtgaaggacgttttgcccgaggctgacaagctcgcagaatttggtgtgaag
cttagagccaagatcttgaaagctagggctactcccaattga

DBGET integrated database retrieval system