KEGG   Durio zibethinus (durian): 111282679Help
Entry
111282679         CDS       T05242                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00350  Tyrosine metabolism
dzi00360  Phenylalanine metabolism
dzi00380  Tryptophan metabolism
dzi00950  Isoquinoline alkaloid biosynthesis
dzi00965  Betalain biosynthesis
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111282679
   00360 Phenylalanine metabolism
    111282679
   00380 Tryptophan metabolism
    111282679
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    111282679
   00950 Isoquinoline alkaloid biosynthesis
    111282679
   00965 Betalain biosynthesis
    111282679
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dzi04147]
    111282679
Enzymes [BR:dzi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     111282679
    4.1.1.105  L-tryptophan decarboxylase
     111282679
Exosome [BR:dzi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111282679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 111282679
NCBI-ProteinID: XP_022726615
Position
Unknown
AA seq 513 aa AA seqDB search
MDGLASINGLGSSYTDNVNPLDPEEFRRQGHMIIDFLADYYQNIEKYPVLSQVEPGYLRK
LLPMSAPYVAEPVEAILQDVQQHIIPGITHWQSPNYFAYFPSSGSVAGFLGEVLSTGFNV
VGFNWISSPAATELESIVMDWLGQMLQLPQSFLFSGNGGGVIQGTTCEAMLCTLTAARDQ
MSSKIGRDNIGKLVVYGSDQTHSALAKAANIAGINPKNVRAIKTTKSTSFGLSPESLQIA
ISFDEKAGLIPLYLCATIGTTSTTAVDPLGPLCDVAKRYGMWVHVDAAYAGSACICPEFR
HFISGAEGANSFSLNAHKWFFTTLDCCCVWVKDPSTLIKSLSTNPEYLRNKASDTKQVVD
YKDWQITLSRRFRAMKLWLVLRSYGVANLRNFLRSHVKMAKLFEELVASDNRFEVVVPRY
FAMVCFRVLPSALCKFQNEYCDKDDVDQTHANEFNRKLLESMNASGRIYITHAQVDGIYM
LRFAVGATLTEDKHVIMAWKVIREMVDTMLNTE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggatggccttgcatctatcaatggactagggagcagttataccgacaacgttaacccc
ctagatcctgaggaattcagaaggcaaggtcacatgatcatagatttcctagctgattat
taccaaaacattgagaaatacccagttctcagtcaagttgaaccaggctaccttcgaaaa
ctcttgccaatgtccgcaccatacgttgctgaacccgtggaagctatccttcaagatgtt
cagcaacatattatccctgggataacacactggcaaagtcctaactattttgcatatttt
ccttcaagtggtagcgttgctggcttccttggagaagtgcttagcaccggcttcaatgtg
gtgggcttcaactggatatcatcaccggctgcgacggagctagaatccatagtcatggat
tggcttggacaaatgcttcagcttcctcagagtttccttttctccggaaatggagggggt
gtgatacagggaactacttgcgaggccatgttgtgtacgctaacagctgcaagagatcaa
atgtcgagcaaaattgggagggataacatcgggaaattagttgtctatgggtcggaccaa
acacatagtgctctagcaaaggcggctaatattgccggtatcaaccctaagaacgttcga
gccatcaagacaacaaaatcaacatcatttggtctgtcaccagaatcattacaaattgca
atcagctttgacgaaaaagctggattaatcccactctatctatgtgccacaattgggaca
acatcaacaactgctgttgatccattgggaccactatgtgatgtggccaaaagatacgga
atgtgggttcatgttgacgctgcttacgcgggaagtgcctgcatttgccccgagttccga
cattttatcagtggcgcagaaggtgcaaattcttttagcctgaatgctcataaatggttc
ttcaccactttagattgttgttgtgtttgggtgaaggatccaagtactctcataaaatct
ctctcaacaaatccggaatacctgcgaaacaaagctagtgatacaaaacaagtcgtagac
tacaaagattggcagataactctcagcagaaggtttcgagctatgaaactttggcttgta
cttagaagttatggtgttgccaatctcagaaactttctaagaagccacgtcaaaatggca
aaacttttcgaagaacttgtggctagcgataataggtttgaagtagtagtacccaggtat
tttgctatggtctgttttagggttttgccatcagcattgtgtaaatttcagaatgaatat
tgtgacaaagatgatgtcgatcagacgcacgcaaacgagtttaaccgaaaactgttagag
tcaatgaacgcatcagggaggatatacataactcatgctcaggttgatggcatttatatg
ctgagatttgctgttggggccactcttacagaggataaacatgttatcatggcttggaag
gtgatacgagagatggtggataccatgctcaacacagaataa

DBGET integrated database retrieval system