KEGG   Durio zibethinus (durian): 111284860Help
Entry
111284860         CDS       T05242                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial-like
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00970  Aminoacyl-tRNA biosynthesis
dzi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111284860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dzi03029]
    111284860
Enzymes [BR:dzi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     111284860
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     111284860
Mitochondrial biogenesis [BR:dzi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    111284860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 111284860
NCBI-ProteinID: XP_022729654
Position
Unknown
AA seq 142 aa AA seqDB search
MGSRALLMFSNFKLKGSFSFASSPSKPFFLINNNPKIRDFSTKTRSSLQPPDVPRLAETA
RISLATNEVEEFAPKIRQVIDWFGQLQAVDLDSVEPAIRADSEGDQLREDVPERFDNKEA
LIASVPSYEEPYIKVPKVLNKE
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggggagcagagctttgctgatgttcagcaacttcaagttgaagggcagcttctctttt
gcttcttcaccttcaaaacccttttttcttattaacaataatcccaaaatacgagatttt
tctacgaaaacgaggtcgtctttgcaaccaccggatgtgcctcgcttggctgaaacagct
cgaatttcactcgctactaatgaggttgaagaatttgctcccaaaatccgacaagtgata
gactggtttgggcaacttcaagctgttgatcttgacagcgtggagcccgctattagagca
gactctgaaggtgatcaactgcgtgaagatgtccctgaaagatttgataataaggaagca
ctgatagcgtctgttccaagctatgaggagccatatatcaaagttcctaaagtattgaac
aaggagtaa

DBGET integrated database retrieval system