KEGG   Durio zibethinus (durian): 111285939Help
Entry
111285939         CDS       T05242                                 

Definition
(RefSeq) lysM domain receptor-like kinase 3
Organism
dzi  Durio zibethinus (durian)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LysM
Motif
Other DBs
NCBI-GeneID: 111285939
NCBI-ProteinID: XP_022731383
Position
Unknown
AA seq 598 aa AA seqDB search
MCFEDLGNFEKLVGFIVLTWLSCSSHSLPCNVSLAESCPASLYYVPRTRKSLEETAALFH
VNLNAINRTTEGFLIAINCSCLAGHDEFTWHVEYEVQPEDTWDVISSKFGSFVVEYPERK
LIPSQIVTLDTLCGCSGSADTVTYKVTKGDTLYTICSRFGADLNKTVKLNRIENAEFIHN
GDVIFIPEPEGLPNLIVLDNKDSSTKKASKSRINAVVGAISAAFAIILLTVIFVSWKNCK
KKGSQVPIFYSRKMDHLHSYFDSRTFLTKSVESIVSSFNSSKAILFPYHEVRVATSNFSM
SLKIGQGSYGSVYLGKLRGTDVAIKQMKNTKSKEFLSEINILCKVQHSNLIELIGYAAGG
DSLYLVYEFAQNGALSDHLHVSSDRGYKPLDWTMRVQIALDAAKGLEYIHKHTKPYYVHR
DVKTSNILLDSNFRAKIADFGLVKLLEHSPEVGAAASRIVGTFGYLSPEYVRDGRVTTKT
DVYAFGVVLMELLTGQQALSRDANPGNNNYSEHRTVVDYMLSALNDTQKPMIELAKCIDP
NLTHYHKDSVLEMALLSKDCVGDNWNQRPDMSEVVFRLSHIFVSSEEWEKQPCTQTES
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtgctttgaggatttggggaatttcgaaaagttggtgggttttatcgtattgacttgg
ctttcatgcagtagccatagtcttccttgcaatgtgtcattagctgaatcttgtcctgct
tcactatattatgttccaagaaccaggaaaagcctggaagaaacagctgctctattccat
gtaaacttaaatgcgattaatagaaccactgagggtttcttgattgcaataaattgcagc
tgcctagctggccatgatgagtttacttggcatgtggagtatgaagtccaacctgaggat
acatgggatgtcatttcatcaaaatttgggtcatttgttgtggaatatcctgaaaggaaa
ctgattccatcacaaattgtgactttagatactttatgtggctgttctgggagtgcagat
actgtcacgtacaaggtcacaaagggagatacactctatacaatctgttcacgattcggt
gcagatctaaataagactgtcaagttgaataggattgagaatgcagagtttattcataac
ggagatgtgatctttattcctgaaccagagggccttccaaaccttatcgtgcttgacaac
aaagattcaagtaccaaaaaggcatcaaaatctcgaatcaatgccgtggttggagccatt
tcagctgcttttgctattattctcttgacagtaatatttgtttcttggaagaactgtaaa
aagaagggaagtcaagtaccaattttctattcaagaaagatggatcacttgcattcatat
tttgattcacgcacttttctcacaaaatctgtagaaagcattgtttcatcgttcaattcc
agtaaagctattttgtttccttatcatgaagttcgtgtagcaacttctaactttagtatg
tctttaaagattggccaaggctcatatggatctgtttacctcggaaaattaagaggaact
gatgtggccatcaagcagatgaaaaacacaaaatcaaaagagttcttatcggagataaat
attctttgtaaagttcaacattcaaatttgattgagcttatcgggtatgctgctggtgga
gactccttgtatcttgtttatgaatttgcccaaaatggtgcattaagtgatcatctgcat
gtctccagtgataggggttataagccacttgattggactatgcgtgttcagattgctcta
gatgcagcaaaaggtcttgagtacatacataagcacacaaaaccatattatgttcatcga
gatgtgaaaacaagcaatattctcttagattccaattttcgtgcaaagattgcggatttt
gggctggtaaaactattggagcattctccagaagttggtgctgcagcgtcaagaattgtt
ggcacatttggttatctttcccctgagtacgttcgagatggacgtgtgacaacaaagact
gacgtttatgcctttggagttgtccttatggaactactaactggccaacaggctctaagc
agagatgcaaaccctggaaataataactacagtgaacataggacagtggtggattatatg
ttatcagcattaaatgatacccaaaagcccatgattgagcttgccaaatgcattgatcca
aaccttacccactaccacaaagactctgttttagagatggcattattgtccaaggattgt
gtgggtgataactggaaccagcgtccggacatgtcagaagttgtgttccgcctgtcacac
atttttgtgagctctgaggagtgggagaaacaaccatgcactcaaacagaatcctga

DBGET integrated database retrieval system