KEGG   Durio zibethinus (durian): 111290419Help
Entry
111290419         CDS       T05242                                 

Definition
(RefSeq) malate synthase, glyoxysomal
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00620  Pyruvate metabolism
dzi00630  Glyoxylate and dicarboxylate metabolism
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
dzi01200  Carbon metabolism
Module
dzi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111290419
   00630 Glyoxylate and dicarboxylate metabolism
    111290419
Enzymes [BR:dzi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     111290419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 111290419
NCBI-ProteinID: XP_022737455
Position
Unknown
AA seq 567 aa AA seqDB search
MIGLGTYGCSAPAARKINAYNVPEGVDVRGRFDEEFGKILTKDALQFVADLQREFRNHIK
YAMECRKEAKRRYNEGALPGFDPATRYIREGQWTCAPVPPAVADRRVEITGPVERKMIIN
ALNSGAKVFMADFEDALSPSWENLIRGQINLKDAVDGTITFHDRARNRVYKLNDKIAKLF
VRPRGWHLPEAHILIDGEPATGCLVDFGLYFYHNYASFRNTLGEGFGPFFYLPKMENSRE
AKIWNFVFEKAEKMAGIEKGSIRATVLIETLTAVFQMDEILYELRDHSVGLNCGRWDYIF
SYVKTFQGHLDRLLPDRVQVGMTQHFMKSYSDLLIRTCHRRGVHAMGGMAAQIPIRDDPA
ANEAALDLVRKDKLREVKAGHDGTWAAHPGLIQACTEVFTNNMGNAPNQIQTAKREDAAN
LTEEDLLQRPRGFRTMEGLRQNTCVGIQYLAAWLTGTGSVPLYNLMEDAATAEISRVQNW
QWLKHGVELDGDGVGVRVNRDLFWRVVEEEMARIEREVGKDKFRKGLYKEACKIFTRQCT
APTLDDFLTLDAYNHIVKHHPEGVSKI
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgattggccttgggacttacggttgtagtgcgccagctgcgaggaagatcaatgcttat
aatgtccctgaaggagtagacgttcggggtcgatttgatgaagagtttggtaagattttg
acaaaggatgctttgcaatttgtggctgatttgcagagggagttcaggaaccatatcaag
tatgcaatggagtgtcgcaaggaagcgaaaaggcggtataatgaaggggcattgccgggt
tttgatccagctacaaggtacatcagagaagggcagtggacttgtgcaccagtcccacca
gctgtggctgacagaagggtggaaattacgggtcctgtggagaggaagatgatcatcaac
gctctcaactctggagctaaagtgtttatggctgattttgaagatgcactctcaccaagt
tgggaaaatcttataaggggtcaaattaacttaaaggatgctgtggatggaacaataacc
ttccatgacagggccaggaacagggtttacaagctcaatgacaagatagctaagctgttt
gttcgtccacgaggttggcatctacctgaggctcacattctcattgatggggagcctgca
actggttgtcttgtggattttggcctttatttttaccacaactatgcctctttccgcaac
actctgggtgaaggatttgggcccttcttctatcttcctaagatggagaattcaagggaa
gctaaaatatggaattttgtgtttgagaaggcagaaaagatggcaggaatagaaaaagga
agcatcagggcaactgttctaattgaaacacttacagctgtcttccaaatggatgaaatc
ctttatgagcttagagatcactctgttggtctaaactgtggacgatgggattacattttt
agctatgttaagacatttcaaggtcacctggatagattgttgccagacagggttcaagtt
ggtatgactcaacacttcatgaagagttactctgatctcctcatcaggacatgccatagg
cgtggtgtccatgccatgggtggaatggcagctcagattccaattagagatgacccagca
gcaaatgaggcagcccttgatcttgtaaggaaggataaactaagagaggtgaaggcaggg
catgatggaacttgggcagctcacccaggactcatccaagcctgcacggaagtcttcacc
aacaacatgggaaatgctcccaatcaaatccaaaccgccaaacgagaagatgcagctaac
ttaacagaagaagacctattgcaaaggcctagagggttccgtaccatggaaggcctccgc
caaaatacttgtgttgggatccagtacttggcagcctggctaactggcacagggtcagtc
cctctttacaacctcatggaagatgctgccacagctgagatcagcagagttcagaactgg
caatggctgaaacacggagtggaattggatggagatggagttggggttcgagtgaaccgt
gatctcttttggcgagtggtggaagaagagatggccaggattgagcgagaggttggaaaa
gataagttcagaaagggactgtacaaagaagcttgcaagattttcacccgccaatgtact
gctcctaccctggatgatttcctcactcttgatgcctataatcacattgtcaagcatcat
cctgagggtgtatctaagatctga

DBGET integrated database retrieval system