KEGG   Durio zibethinus (durian): 111290775Help
Entry
111290775         CDS       T05242                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: acid beta-fructofuranosidase 1, vacuolar-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00052  Galactose metabolism
dzi00500  Starch and sucrose metabolism
dzi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    111290775
   00500 Starch and sucrose metabolism
    111290775
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     111290775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 111290775
NCBI-ProteinID: XP_022737974
Position
Unknown
AA seq 641 aa AA seqDB search
MEASTSHDPEQNPAFNAPLLDHPSSGGAPSTRSRPLKGFAVIFASVVFLLSLVTLIINQS
QEPLPTLNRXPSPSYSKAQAQPRGIAEGVSAKSNPSLLNEVLFNWTNAMFSWQRTAYHFQ
PEKNWMNDPNGPLYHMGWYHLFYQYNPYSAIWGNITWGHAVSRDLIHWLYLPLAMVPDQW
FDINGVWTGSATLLPDGQIVVLYTGKTNESVQVQNLAYPSNLSDPLLLHWLKYPGNPVML
PPPGIKADDFRDPTTAWLGPDGTWRLTLGSKFNTTIGISLVYQTTNFRDYELLDGVLHAV
PGTGMWECVDFYPVATNGSVALDTSALGPGIKHVLKASLDDTKVDHYAIGTYDLITDKWT
PDNPKEDVGIGLRVDYGRYYASKTFFDQNKQRRVLWGWINETDTETADLTKGWASLQTIP
RTVLYDNKTGTNILQWPVEEVESLRLNSTVFKEVLVEAGSVVPLDIGSATQLDILAEFEI
ESLVSNTTDEFSDCGDGAVDRSIFGPFGLLVIADDSLSELTTVYFRPVNSSDGNLKTYFC
ADETRSSKASDVFKEVYGSKVPVLDDENYNMRVLVDHSIVESFAQGGRTVITSRIYPTEA
IYGAARLFLFNNATGVNVKATLKIWEVNSAFIRPFPFDETL
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggaggccagtacctcccatgaccctgaacaaaacccagcattcaatgctcccttgcta
gaccacccctcctccggcggagcgccatcgacccggagtagacccttgaagggttttgca
gtgatctttgcttccgtcgttttcctactctcattggtcacattaatcattaaccaaagc
caagaaccattaccgacgctcaacaggnngccgtcaccttcgtattcaaaggcccaggcc
cagccgagagggatcgctgaaggtgtgtcagccaagtcaaatccatctcttctgaacgaa
gttttgtttaattggacaaacgctatgttttcttggcaaagaacagcctaccactttcag
cctgaaaagaattggatgaatgatcctaacggtccattatatcacatgggatggtaccat
cttttctatcaatacaatccttattcagctatatggggcaacatcacatggggccacgcc
gtgtcaagggacctgattcattggctctatctcccactcgccatggtccccgatcaatgg
ttcgatatcaacggtgtatggacggggtctgccactctcctgccagatggccaaatcgta
gtactttacacaggcaagaccaatgagtccgtgcaagtgcagaaccttgcatacccctct
aacctatctgatcccctcctccttcattggttaaaatacccgggtaacccggttatgctt
cccccacccgggattaaagccgatgatttccgggacccgacaactgcttggcttggaccc
gacggtacctggcggctcacgctgggctcaaagtttaataccacaattggaatctccctt
gtttatcaaacaacaaattttagggattatgaattattggatggggttttacatgcagtt
ccgggtacgggtatgtgggaatgcgtggatttttaccctgttgcaacaaacgggtcggta
gcgttggacacatccgcgcttgggcctggaatcaagcatgtgttaaaggctagtttggat
gataccaaggtggaccattatgcaattgggacttatgacctgataacggataagtggacg
ccagataacccgaaagaggatgtgggtataggtttgagggtggattatggaagatactat
gcctcaaagacattttttgatcagaataaacaaaggagggtactttggggttggattaat
gaaactgatacagaaactgctgacttgacaaaaggatgggcttcccttcagacaattccc
aggaccgttctgtatgacaacaagactggaaccaatatacttcaatggccagtggaagaa
gtagagagcttgagattgaacagtacagtgtttaaagaggtgctagttgaagcaggatca
gttgtgcccctcgacataggcagtgccactcagttggatatactagcagagtttgaaata
gagtcattggtatctaataccacagacgaattcagtgattgcggtgatggtgcggttgac
aggagcattttcgggccatttggactcctggttatagctgatgattcactttctgagctg
actactgtatatttccgtccagttaattcatctgatggcaatctcaagacttacttttgc
gctgacgaaacaaggtcttctaaagcttctgatgtcttcaaagaggtgtatggaagcaaa
gttccagtgcttgacgatgaaaactacaatatgagggtactggtggatcattcaatcgtg
gaaagctttgctcaaggagggaggacggtgatcacatcaagaatttatccaaccgaagcc
atctatggagcagcacggctattcttgttcaacaatgcaactggagtaaatgtgaaggcc
acacttaaaatatgggaagtgaattctgcgtttattcgtcctttcccttttgacgaaaca
ttgtag

DBGET integrated database retrieval system