KEGG   Durio zibethinus (durian): 111291139Help
Entry
111291139         CDS       T05242                                 

Definition
(RefSeq) uncharacterized protein LOC111291139 isoform X1
  KO
K06195  ApaG protein
Organism
dzi  Durio zibethinus (durian)
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    111291139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354
Motif
Other DBs
NCBI-GeneID: 111291139
NCBI-ProteinID: XP_022738481
Position
Unknown
AA seq 298 aa AA seqDB search
MHSLSLKVFTDLNAGTRRNRFPGRVGQGLSADLHFGGKRRVGSGCWDGGVAWKCRIVACA
VERNGNGGGGESPSLNPNPTRNESSFLSRSQTYAMLKHQMEVAAKSEDYKEAARIRDSLK
MLEEEEPILRLRRLIKEAVADERFEDAARYRDELKEIAPHSLLKCSSDATTLGIRVQVRS
VYVEGRSIPSRDQYVFAYRIRIINNSDRPVQLLRRHWIITDGNGKTESVWGIGVIGKQPV
ILPRTGFEYLSACPLSTPNGRMEGDFEMKHIDRVGTPSFNVAIAPFSLSTLGDDAGTF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgctgagccttaaggttttcactgatttgaatgcgggtacgaggaggaaccgg
tttccgggtagggtcggtcaggggttgtcggcggatctacactttggggggaagagaagg
gttgggtcgggttgttgggatggtggcgttgcgtggaagtgtaggatagtggcttgtgcg
gtggagaggaacgggaatggtggtggaggggagagtccgagtttgaacccgaatccaact
cggaatgagagttcgtttctttctcggagccaaacttatgcaatgctgaaacatcaaatg
gaggttgctgctaaatctgaggattataaagaagcagcgaggatacgtgattctttgaaa
atgttggaggaagaagagcctattttgagacttaggaggctgattaaagaagctgttgcc
gatgaaagatttgaggatgcagctaggtatcgtgatgagttgaaagaaatagcaccccac
tctctcctgaagtgttcaagtgatgcaacaaccttgggaatcagagttcaagttaggagt
gtgtacgtagaggggcgtagtataccttcaagggaccagtacgtttttgcatatagaata
agaataatcaataactcagatcgtcctgttcagcttctcagaaggcattggattatcaca
gatggcaatgggaaaactgaaagtgtttggggaattggagttataggcaaacagccagtt
atacttcccagaacaggtttcgaatacttatctgcttgcccgttaagtactcccaatggc
agaatggaaggagactttgagatgaaacacattgacagagtaggcacaccgagtttcaat
gtagccatcgccccattttctctctccacactaggggatgatgctggtaccttctga

DBGET integrated database retrieval system