KEGG   Durio zibethinus (durian): 111293182Help
Entry
111293182         CDS       T05242                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH11, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111293182
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dzi03041]
    111293182
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111293182
Spliceosome [BR:dzi03041]
 Complex C
  Other components
   Step II factors
    111293182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C OB_NTP_bind IBR HA2 DEAD AAA_19 AAA_22 RRM_1 ABC_tran Helicase_RecD AAA_29 AAA_30
Motif
Other DBs
NCBI-GeneID: 111293182
NCBI-ProteinID: XP_022741693
Position
Unknown
AA seq 1760 aa AA seqDB search
MKNFSSYSNHRHPPSPGGHIPYRHDQHSNRNDHHQRPNFPVVSNQNHRRRHPPSLHSAVG
YTNSNILPLPNFIIELLHESSSPFPSKPNNLQAIISQLNPSPESFEIRTTGKIAAYIYFR
EWSHTLSSILSLWRSRLDGSHQFTPNVISNVLVPSDTVELKENLRTLFSDHIKGLMEGEL
AKKWQKKIEELSDEIVDLSGQMGKRHYQVGRFSELNDKKKALMAERLMISKRLREFKGGM
RSLLGCLEDGEIGNEEEEEGVDAFRLDGGFDWKRIHKLILRECRRLEYGLPIYAHRKEIL
TRIHREQIMVLIGETGSGKSTQLVQFLADSGIAADESIICTQPRKIAAISLAERVREESI
GCYDDNSVICYPTFSSAQQFDSKIIYMTDHCLLQHYMKDRDLSGISCIIVDEAHERSLNT
DLLLSLVKGLLGRRLDLRLIIMSATANANQLSQYFFDCGIFHVIGRNFPVDIKYVPCATE
GTSSSGVVASYVSDVMRMAVKVHKTEKEGNILAFLTSQMEVEWACEHFEAPNAVALPLHG
KLSFDEQFHVFQNYHGKRKVVFATNIAETSLTIPGIKYVIDSGMVKESKFEPGTGMNVLK
VCWISQSSANQRAGRAGRTEPGRCYRLYTESDFESMPPNQEPEIRRVHLGVAVLRILALG
IKNVQSFDFVDAPSSKAIDMATRNLIQLGAIVENNGVFELTDEGRYLVKLGIEPRLGKLI
LSCFPFGLRREGLVLAAVMANSSSIFCRVGNDDDKIKADCLKVQFCHRNGDLFTLLSVYK
EWEALPHHRKNKWCWENSINAKSMRRCQDTVTELEMCLQKELAVIIPSYLLWDPHKSTEH
DKCLKAIILSSLAENVAMYSGYDQLGYEVALTGQHVQLHPSCSLLIFGQKPSWVVFSELL
SITNQYLVCVTAFDFESLATLHPPPLFDVCKMESHKLQVKALTGFGSTQLKKFCGRSNHN
LRSLLSRIRTACMDERIGIQVNIEQNEILLFASSMDMQKVLASVNEVLECERKWLLNECM
EQRLFRGPSASPSMALFGAGAEIKHLEVDKRSLTVDVFHSNVNNLEDKELLMFFEKYSDG
SICSVHKSQANGQESDDKEKWGKITFLTPDAARKAAELDGVDFAGSPLKVLPSRISFGGD
HKMFSFPAVKAKVYWPRRASKGFGVIRCDLLDVGFIIDDFSNLVIGGKFVRCEVSRKSVG
SVGSVVIYGIDKELSEAEVWDALQRATERKIHDFFLVRGDAVENPTCGACEEALQREISP
FMPKRNLHTNYCRVQVFQPEPKETFMKALITFDGRLHLEAAKALEQLEGKVLPGCLSWQK
IRCQQVFHTSISCSSSVYAVIKKQLDSLLASFRRLKGVDCNLEANENGSYRVRISANATK
TVAELRRPVEELMNGRNIEHASLTPSILQHLFSRDGIYLMRSLQRETKTYISFDRHSLNV
RIFGSPEDAAVAQQKLIQSLLSYHESKQLEVRLHGPGLPPDLMKKVVKKFRPDLHGLKEK
IPGAEFTLSTRHHVISVRGDKETKRKVEEIVLEIAETGKDLAEGSDSEVTCPVCLCEVED
GYKLEGCSHFFCRLCLVEQCESAIKNLDSFPICCAHQGCKVPIFLTDLKFLLSTEKLEEL
FRAALGAFVASSRGTYRFCPSPDCPSVYRVADPETFGEPFVCGACYAETCTRCHMEYHPY
LSCEKYREFKDDPDSSLKEWCKGKEQVKTCPICGYTIEKIDGCNHVECKCGRHVCWVCLE
FFSSSDDCYGHLRAVHMAII
NT seq 5283 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatttctcttcatactccaaccaccgtcacccgccttctccgggcggccatata
ccctaccgtcatgaccaacacagcaaccgaaacgatcaccatcaaagacccaattttcct
gtagtaagtaaccaaaaccaccgtcgtcggcacccaccttcactgcacagtgccgttggt
tacaccaattccaacatcctcccactcccaaacttcataattgagctccttcacgaatct
tcctccccattcccttctaaacctaacaacctacaagctattatctcccaacttaaccca
tcccctgaaagtttcgagattcgcaccactggaaaaatcgccgcttacatatatttccgg
gaatggtcccacaccctctcttcgattctttctctctggcgttcccgccttgatgggtct
caccaatttactcccaatgttatttccaacgtccttgtgccttccgacacggtggaactc
aaagaaaaccttagaacccttttctccgaccatataaaggggttgatggaaggggaattg
gctaagaagtggcagaaaaaaatcgaggaactatccgatgagattgttgacttgtcagga
caaatgggtaagaggcattatcaggtaggaaggttttctgagttgaatgacaagaagaaa
gctttgatggcggagaggttgatgatttcgaagcggttgagggagtttaagggcgggatg
aggagtttgttagggtgcttggaagatggggaaatcgggaatgaggaagaagaggaaggt
gtggacgctttcaggcttgatggggggtttgattggaagagaattcataagctgattttg
agagaatgtaggaggttggagtatggtttgcctatatatgctcataggaaagagattctc
actagaatacatcgtgaacagataatggtattgattggagagactggatcaggaaagagt
acacagctggttcagtttcttgctgattcaggaatcgctgctgatgagtcaattatatgt
actcagccaagaaagattgctgctatctcattagcagaaagagtgagagaagaaagcatt
ggatgttatgatgataattcagtcatttgttatccaacgttttcatctgctcagcaattt
gattccaaaataatatatatgaccgaccactgtttactgcagcattatatgaaggatagg
gatttgtcaggaatttcttgcattattgttgatgaggcccatgagagaagtttgaacact
gatcttcttttgtcattggttaaaggtttacttggtcgaagacttgatttaaggcttata
ataatgtctgcaacggccaacgcaaatcaactctcacaatacttttttgattgtggaatc
tttcatgtgatcgggagaaactttcctgttgatattaaatatgttccttgtgcaactgag
ggaacttctagttctggtgtggttgcttcatatgtttctgatgtcatgaggatggctgtt
aaggttcataaaacagagaaggaggggaacattcttgcttttttgacttcccagatggag
gtagaatgggcttgtgaacattttgaagctccaaatgcagttgcattaccattgcatgga
aagctttcctttgacgagcaatttcatgttttccagaactaccatgggaaaagaaaagtt
gtatttgcaactaatattgcagagacatcacttactattcctgggatcaagtatgtgatc
gattctggtatggtcaaggagagtaaatttgaacctggcactggaatgaacgttctcaaa
gtctgctggattagccagagttctgctaatcaacgggctggtcgtgctgggaggacagaa
ccaggaagatgctacagactatacactgaaagtgattttgagtcaatgccccctaatcag
gagcctgagattcgcagagttcatcttggtgttgcagttctgaggatccttgctttggga
atcaagaatgttcagagttttgattttgttgatgcacctagttctaaagccattgacatg
gcaactaggaatcttatccagttgggagccattgtggaaaataatggtgtttttgaatta
actgatgaaggacggtacttggtaaaattggggattgagcctcgccttggtaaactgatt
ctcagttgcttcccgtttggtctgcgtagagagggtcttgttcttgctgctgttatggca
aattccagtagcatattttgcagggtgggtaatgatgatgacaagataaaagctgattgt
cttaaggtgcaattttgccacaggaatggtgaccttttcactctgctctctgtgtacaag
gagtgggaagctctcccacaccacaggaaaaataaatggtgctgggaaaacagtataaat
gctaagtcaatgcggagatgccaagacacagtcaccgaattggaaatgtgtctgcaaaag
gaacttgctgttattattccaagttacttgttgtgggatcctcataagtctactgagcat
gataaatgtttgaaggctattatactttcttcgcttgctgaaaatgttgccatgtattct
ggttacgatcaacttggttatgaggtggcattgactggacaacatgtgcagctgcatcct
tcgtgttcattgctgatatttggtcagaagccaagttgggttgttttcagtgaactctta
tcaataactaatcagtacttggtctgtgtaactgcttttgattttgaatctttagccact
ctccatcctccacccctgtttgatgtgtgtaagatggaaagccataagttgcaagtgaag
gcattgactggttttggtagtactcaactaaaaaaattttgtgggagatccaaccataat
cttcgatctcttttatcacggattaggactgcctgtatggatgaacgaattggtattcag
gtcaatattgagcagaatgagattctgctgtttgcctcatcaatggacatgcagaaggtt
ctggcttctgtgaatgaggtgctggaatgtgaaaggaaatggttacttaatgaatgcatg
gagcaacgtttatttcgtggtccgagtgcctcgccatctatggctctttttggagcaggt
gctgagattaagcatcttgaagttgataagagatctttgactgtggatgtattccattca
aacgttaacaatcttgaagataaggagcttttgatgttctttgagaaatattctgatggc
agtatttgttctgtccataaatctcaagccaatggacaagagagtgatgataaggaaaaa
tggggcaagataacattcctaactcctgatgctgccagaaaagctgctgagctggatgga
gttgactttgctggctctccattgaaggtacttccttcaaggatatcctttggaggtgat
cataagatgttctccttccctgctgtcaaagcaaaggtttattggcctcgtagggccagt
aaagggtttggagtcattagatgtgatctgcttgacgttggtttcattattgatgatttc
tctaatctggtaataggggggaaatttgttcggtgtgaagttagcaggaaatctgttggt
tctgttggttctgtagtgatttatggaattgataaagagctttctgaagctgaagtttgg
gatgcactacagagggcaacagaaaggaaaatccatgatttcttcctggtgagaggagat
gctgtggaaaatccaacatgtggtgcttgtgaagaggcactccagagagaaatatccccc
tttatgcctaaaaggaatctccatacaaattattgtcgggttcaggttttccagcccgaa
ccaaaggaaactttcatgaaagccttgatcaccttcgatggaagattacatttggaggct
gcaaaagctttagagcagctagaggggaaagtattacctggatgtttgtcatggcagaag
ataaggtgccagcaagtgtttcatacctctatatcctgctcttcatctgtctatgctgtt
attaagaagcaactggattctttactagcaagcttcagacgtctaaaaggtgtagactgc
aatctagaggcaaatgaaaatggctcctatcgggtgagaatatctgccaatgccaccaaa
actgtggcagagttgagaaggccagtggaagagctaatgaatggtaggaacatagaacat
gccagcctcactccttccatattgcagcatctgttctctagggatggcatttatctgatg
agatcattgcagcgagagacaaaaacctacatttcttttgacaggcatagtctcaatgta
agaatctttggctctccagaagatgctgctgtagcccagcaaaaattgattcaatccctt
ttgtcttaccatgagagcaagcagcttgaggtccgacttcatggtccgggtctgcctcct
gacctgatgaagaaagtggttaagaaattcaggccagaccttcatgggctgaaagagaaa
atacctggggccgagtttacacttagcaccaggcatcatgttatatcggttcgtggtgac
aaagagacgaagcgaaaggtagaagagattgttcttgagattgcagagacaggtaaagat
ttagctgagggatctgatagtgaagttacctgccccgtttgcttgtgtgaagtagaagat
ggctacaagcttgaaggttgttcccatttcttctgtcggttgtgtttggtggagcaatgt
gagtctgctatcaaaaacttggatagtttcccaatatgctgtgcccaccaaggttgcaag
gttcccatattccttactgatttgaagtttctcctttcaactgagaagctagaggaactc
tttagggctgctttaggggcatttgttgcttcaagtaggggcacctatagattttgccca
tctcctgattgcccttcagtttatcgcgttgctgatcctgagacttttggtgagccattt
gtctgtggagcatgttatgcagagacttgtactaggtgccacatggagtatcatccatat
ctgtcatgtgagaagtaccgagagttcaaggatgatcctgattcatctttgaaagagtgg
tgcaaaggaaaagagcaggtgaaaacttgcccaatctgtggatatacaattgagaagatc
gacgggtgtaaccatgtcgaatgtaagtgcgggaggcatgtttgctgggtatgtttagag
ttctttagtagcagtgacgattgttatggtcatttgagggctgttcacatggccatcatc
taa

DBGET integrated database retrieval system