KEGG   Durio zibethinus (durian): 111295678Help
Entry
111295678         CDS       T05242                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi03040  Spliceosome
dzi04141  Protein processing in endoplasmic reticulum
dzi04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111295678
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111295678
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111295678
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dzi01009]
    111295678
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dzi03041]
    111295678
   03009 Ribosome biogenesis [BR:dzi03009]
    111295678
   03110 Chaperones and folding catalysts [BR:dzi03110]
    111295678
   04131 Membrane trafficking [BR:dzi04131]
    111295678
   03051 Proteasome [BR:dzi03051]
    111295678
   03029 Mitochondrial biogenesis [BR:dzi03029]
    111295678
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dzi04147]
    111295678
Protein phosphatases and associated proteins [BR:dzi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111295678
Spliceosome [BR:dzi03041]
 Complex B
  Other components
   Prp19 complex
    111295678
 Complex C
   Prp19-CDC5 complex
    111295678
Ribosome biogenesis [BR:dzi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111295678
Chaperones and folding catalysts [BR:dzi03110]
 Heat shock proteins
  HSP70 / DNAK
   111295678
Membrane trafficking [BR:dzi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111295678
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111295678
Proteasome [BR:dzi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111295678
Mitochondrial biogenesis [BR:dzi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111295678
Exosome [BR:dzi04147]
 Exosomal proteins
  Proteins found in most exosomes
   111295678
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 111295678
NCBI-ProteinID: XP_022745021
Position
Unknown
AA seq 646 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
QVAMNPVNTVFDAKRLIGRRFSDASVQSDIKLWPFKVISGPGDKPMIVVSYKGEDKQFAA
EEISSMVLMKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRALRRLRTSCERAKRTLSSTAQTSIEIDSLYEGIDFY
STVTRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
KVESKNALENYAYNMRNTVRDEKIGAKLSPEDKKKIEDAIEQAIQWLDSNQLAEADEFED
KMKELESICNPIIAKMYQGAGADMGGMDEDVPAGGSGAGPKIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggccggtaaaggagaaggtccagcgatcggaatcgatctcggaaccacttattcttgc
gttggcgtttggcaacatgatcgtgttgagatcattgccaacgatcaaggtaacagaacg
acgccgtcttatgttggctttactgataccgagcgtttgatcggcgatgcagcaaagaac
caggtcgccatgaaccccgtgaacaccgtcttcgatgcaaagaggttgattggtcgtaga
ttcagtgatgcctctgttcagagtgatattaaattgtggccattcaaggtcatctctggg
cctggtgacaagcccatgattgttgtttcttacaagggtgaggacaagcaatttgctgct
gaggagatctcttctatggtactcatgaagatgcgtgaaattgccgaggcttaccttggc
tctacagttaagaatgccgtggttactgtacctgcatacttcaatgattcacagcgtcag
gcaacaaaggatgctggtgtcattgctggtcttaatgtcatgcgtattattaatgaaccc
acggctgcggccattgcttacggtcttgacaagaaggctagtagtgtcggcgaaaagaat
gtcttgatctttgatcttggtggtggtactttcgatgtctctcttcttacaattgaagag
ggtatctttgaagtgaaggccactgctggagacactcaccttggaggtgaagattttgac
aacaggatggtgaaccactttgtgcaggagttcaagagaaagaacaagaaggatattagt
ggtaaccccagagctcttaggaggttgaggacttcttgtgagagggcaaagcgaaccctc
tcatccactgcccaaacctccattgagattgactccttgtatgagggtatcgacttttac
tcaaccgttacccgtgccagatttgaggaacttaacatggatctattcagaaagtgtatg
gaacctgttgagaagtgtttgagggatgccaagatggacaagagcagcgtccatgatgtt
gtgcttgttggtggctctactagaattcccaaggttcagcagcttctgcaggatttcttc
aacggaaaggagctctgcaagagcatcaaccctgatgaggctgtcgcctatggtgctgca
gtccaagctgctatcttgagtggtgagggtaatgagaaggtgcaagatcttttgctcttg
gatgtcacccccttgtcccttggtttggaaactgctggtggtgtcatgactgttttgatt
ccaaggaacaccaccattcccaccaagaaggagcaggtcttctctacctactccgacaac
cagcctggtgtattgatccaggtctatgaaggtgagagaacaaggaccagagataacaac
ttgcttggtaaattcgagctctcaggtatcccaccagctcccaggggtgttccacagatc
actgtgtgctttgatattgatgccaacggtatcttgaatgtgtctgctgaggacaaaacc
actgggcagaaaaacaaaatcaccattacgaacgacaagggaaggctttccaaggaggaa
attgagaagatggttcaagaggcagaaaagtacaagtctgaggatgaagagcacaagaag
aaggtcgagtcaaagaacgcactggagaactatgcttacaacatgagaaacacagtgagg
gatgagaagattggtgccaaactttctccagaagataagaagaagattgaagatgcaatt
gagcaggccatccaatggctagacagcaaccagcttgccgaggcagatgagtttgaagac
aagatgaaggaattggagagcatctgcaaccccatcattgcaaaaatgtatcagggtgct
ggtgctgacatgggtggcatggatgaggatgtcccagctggtggaagcggtgctggccca
aagattgaggaagtggactaa

DBGET integrated database retrieval system