KEGG   Durio zibethinus (durian): 111299901Help
Entry
111299901         CDS       T05242                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)-like
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00010  Glycolysis / Gluconeogenesis
dzi00020  Citrate cycle (TCA cycle)
dzi00620  Pyruvate metabolism
dzi00710  Carbon fixation in photosynthetic organisms
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
dzi01200  Carbon metabolism
Module
dzi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
dzi_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111299901
   00020 Citrate cycle (TCA cycle)
    111299901
   00620 Pyruvate metabolism
    111299901
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111299901
Enzymes [BR:dzi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     111299901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_16
Motif
Other DBs
NCBI-GeneID: 111299901
NCBI-ProteinID: XP_022751154
Position
Unknown
AA seq 655 aa AA seqDB search
MAANGTGVSTPRSQLARIQTQKKGNEMCHDDSGKPVKAQTIDELHSLQKKRSAPTTPLDG
VQGAFASLTEGERQRQQLQSISASLASLTRGTGPKVVKGDPAEKPYAVAHVAHHYHHVEA
PTISVSDSSLKFTHVLYNLSPAELYEQAVKYEKGSFITSSGALATLSGAKTGRSPRDKRV
VIDDTTQYELWWGKGSPNIEIDEHTFMVNRERAVDYLNSLDKVFVNDQFLNWDPQNRIKV
RIVSARAYHSLFMHNMCIRPTLEELENFGTPDFTIYNAGQFPCNRYTHYMTSSSSIDLNL
ARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGKDGDVALFFGLSGTGKT
TLSTDHNRYLIGDDEHCWSDNGVSNIEGGCYAKCIDLSGEKEPDIWNAIKFGTVLENVVF
DEHTREVEYGDKSVTENTRAAYPIEYIPNAKIPCVGPHPKNVILLACDAFGVLPPVSKLS
LAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAMLAKKMQKHGAT
GWLVNTGWSGGSYGSGKRIKLPYTRKIIDAIHSGSLLNATYEKTEVFGLEIPTEIEGVPS
EILHPENTWTDKQAYKDTLLKLGGLFKKNFETFTNYKIGKDNKLTEEILAAGPNF
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaaatggaaccggagtgtcgacgccaaggagtcagttggctaggattcagacg
cagaagaagggcaacgagatgtgtcacgatgacagtggaaaacccgttaaggctcagacg
attgatgagcttcactctttgcagaagaagagatctgcgccaactacgcctctcgacggg
gtccagggtgccttcgctagcttgaccgagggggaacgccagaggcagcagctccagtcc
atcagtgcatctttggcttcactgacgagaggaacaggtccaaaggtggtgaaaggagac
ccagcggagaagccttatgcggttgcgcatgtggcgcaccattaccaccatgtggaggca
ccaaccatcagcgtcagtgacagttctttgaaattcacccatgtcctctacaacctctct
cctgcagagttgtatgagcaggctgtaaagtatgaaaagggttctttcattacatcaagc
ggtgcattagccaccctatcaggagccaagaccggtcggtctccaagagataagagggtt
gttattgatgacaccacccaatatgagctttggtggggaaagggctcacccaacattgaa
atagacgagcataccttcatggtgaacagagaaagagctgttgattacttgaattctctc
gacaaggtttttgtgaatgatcaattcttgaactgggatccacagaacagaatcaaagtc
cggattgtctctgctagagcttatcattcattgttcatgcacaacatgtgtatccgaccc
actcttgaagagctggagaatttcggtactccggacttcactatatacaatgctggacag
ttcccgtgtaaccgttatacacactacatgacatcctctagtagcatagaccttaatctt
gctaggagggaaatggtcattctcggcactcagtacgccggggaaatgaagaagggtctt
ttcagtgttatgcattatctcatgcccaagcgtcaaatcctctccttacattctggctgc
aatatggggaaagatggagatgttgccctcttctttggactgtcaggtactggcaagact
actctgtctactgatcacaataggtatctgattggagatgatgaacactgttggagtgat
aatggtgtgtcaaacattgaaggcggttgctatgccaagtgcattgatctttctggggag
aaggagcctgatatctggaatgccattaagtttggcactgtgttggaaaacgtagttttt
gatgaacatacaagagaggtggaatacggggacaaatcagttacagagaacactcgtgca
gcataccccatcgaatacattcccaatgctaagattccatgcgttgggccacaccctaag
aatgtcatacttttggcatgtgatgcctttggtgtccttccacctgtgagcaagctgagt
ttggcacaaaccatgtatcatttcattagcggctacactgctctggtggctggcacagaa
gatggtattaaggagccaacagcaacattctcagcttgctttggcgcagcatttatcatg
ttgcatcctactaagtatgcagctatgcttgcgaagaaaatgcagaagcatggagcaaca
ggatggcttgtcaacactggctggtccggtggaagctatggctctggaaagcgtatcaag
ttaccatacactcgaaaaatcattgatgccatccactctggtagcctcttgaatgcaact
tacgagaaaactgaggtgtttggattagagatccccactgagattgagggagtgccttca
gaaatcctgcatccagagaacacatggactgacaagcaggcatacaaggacacgctgttg
aaattgggtggcctgttcaagaagaactttgagaccttcacaaactacaagattggcaag
gacaacaagctgactgaggagatcctagcagctggtccaaacttttaa

DBGET integrated database retrieval system