KEGG   Durio zibethinus (durian): 111300604Help
Entry
111300604         CDS       T05242                                 

Definition
(RefSeq) cell division control protein 2 homolog C
  KO
K07760  cyclin-dependent kinase [EC:2.7.11.22]
Organism
dzi  Durio zibethinus (durian)
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dzi01001]
    111300604
Enzymes [BR:dzi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     111300604
Protein kinases [BR:dzi01001]
 Serine/threonine kinases: CMGC group
  CDK family
   111300604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 111300604
NCBI-ProteinID: XP_022751965
Position
Unknown
AA seq 307 aa AA seqDB search
MDKYEKLEKVGEGTYGKVYKAKDKATGQLVALKKTRLEMDEEGIPPTALREVSLLQMLSQ
SLYVVRLLCVEHVDTNKNGGTKANLYLVFEYLDTDLKKFIDSHRKGPNPRPLPPSLIQSF
LFQLCKGVAHCHSHGVLHRDLKPQNLLLDKGKGILKIADLGLGRAFTVPLKSYTHEIVTL
WYRAPEVLLGATHYSTAVDMWSVGCIFAEMVRRQALFPGDSEFQQLLHIFRLLGTPTEKQ
WPGVSSLRDWHVYPQWEPQSLARAVPSLSADGVDLLSKMLKYDPAERISAKAVMDHPYFD
SLDKSQF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggacaaatacgagaaactggagaaggtaggggaaggtacgtacggcaaggtttacaag
gccaaagacaaggctaccggccaattggttgcccttaagaagacccgtcttgagatggac
gaggagggcattcctcccaccgctctccgtgaggtctccctcctccagatgctctcccag
tccctctatgttgtccgtctcctttgtgtcgaacacgtcgacacaaacaagaacggcggc
accaaggccaacctctacttggtcttcgagtaccttgacaccgatctcaagaagttcatc
gattcccatcgcaagggtcccaaccccaggcccctccctccctccctcattcagtccttt
ctcttccagctttgcaaaggcgttgcccactgccacagccacggtgtcctccaccgcgat
ctgaagccccagaaccttcttctggacaagggcaagggcatccttaaaattgcagatctg
ggccttggccgtgctttcactgttcctctcaagagctacactcatgagattgtcacgctc
tggtacagggctccggaggttcttcttggtgctactcactattccaccgccgtcgacatg
tggtccgtcggatgcatcttcgctgaaatggttagaaggcaagcgttgtttcccggggat
tccgaattccagcaattgcttcacattttcaggttgctgggcaccccaaccgagaagcag
tggcctggggtttcgtctctaagggattggcatgtctatccacagtgggagccacagagc
ttggcacgtgctgttccttcactttctgctgatggagttgatcttctatccaagatgctt
aagtatgatccagcagaaagaatatcagcgaaagcagtaatggatcatccttattttgac
agtcttgacaagtcccaattctaa

DBGET integrated database retrieval system