KEGG   Durio zibethinus (durian): 111304121Help
Entry
111304121         CDS       T05242                                 

Definition
(RefSeq) U-box domain-containing protein 51-like
Organism
dzi  Durio zibethinus (durian)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH PIP49_C Haspin_kinase Aldedh
Motif
Other DBs
NCBI-GeneID: 111304121
NCBI-ProteinID: XP_022756371
Position
Unknown
AA seq 693 aa AA seqDB search
MKEVILEDTDICKALLDYVSKNLINSLVLGAATRNGFSRKSKNDIPTSLIKTAPEFCSVY
VICKGKILTMRKAQRTVSNTATPPKAPSGIPPPIPLDQIEDDGNRGQYARGALRNAGSER
LSLDNPPKVPIRDRDRYRSFPENLSLDTIDLAIQGRPSTSNDSLAIDSDFPTKLGLGSMD
ISGQNLDFSVVSSIPSEPLTQNSRDIQAEMRRLKLELKQTMDMYSTACKEALTAKRKANE
LHQWKMEEASKFEEARLAGEAALAIAEMEKAKCKAAIEAAEAAQRLAEMEAHRRRQAEFK
AKKEADEKNRALNALAKNDVRYRKYTIEEIEEATEMFSESNKIGEGGYGPVYKGKLDHTP
VAIKVLRPDAAQGKKQFQQEVEVLCSIRHPNMVLLLGACPEYGCLVYEYMFNGSLEDRLF
RRGNTRPLSWRKRFKIAAEIATALLFLHQAKPEPLVHRDLKPANILIDRNYVSKISDVGL
ARLVPPSVADSVTQYHLTSAAGTFCYIDPEYQQTGMLTTKSDIYSLGIMLLQIITAKPPM
GIAHHVGKAIEKGTFADMLDPTVPDWPVEEALSFAQLALKCVELRKRDRPDLGTVIVPEL
NWLRDLGMSSDSRSLGYSSDGYTGHSSGGYSQGYSGGGHSQGHNYSGHSGSHARSSVSPL
SRSRTSSASQESMSKTENSETEQIPNSKEDEVE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaggttatccttgaggatactgatatctgtaaagcacttttggactatgtcagc
aaaaacttgattaacagtctagtccttggtgcagcaacgaggaatggtttttcaaggaaa
tccaaaaatgacattccgaccagcttgatcaaaactgcaccagagttttgttcggtatat
gtaatttgcaaaggtaagatattgacaatgcgaaaagcacagagaacagtatctaatact
gctaccccgccaaaagcaccatcaggaataccgcctccgatcccgctggatcaaattgaa
gacgatggaaacagagggcaatatgcaaggggagcattgagaaatgcaggatcagagaga
ttgtccttggataatcccccaaaagtacctatacgtgaccgcgacagatatagaagcttt
ccagaaaatctgtcattggacaccattgatttagctatccaaggacggccctcaactagc
aatgattccttagctattgactcagactttccaacaaaacttggccttggatctatggat
atttctggccaaaatttagatttctctgtggtttcaagtatcccttcagagccacttaca
caaaattcgcgagacatacaagctgaaatgagaaggttgaagcttgaacttaagcagacc
atggatatgtacagcacagcttgcaaagaagctcttacagccaaaagaaaggctaatgag
cttcatcaatggaagatggaggaggctagcaagtttgaggaagccaggttagctggagag
gcagctcttgccattgcagaaatggagaaggctaagtgcaaagctgccattgaagcagct
gaggcagcacaaaggctagcagagatggaagcacatagaagaagacaagcagagtttaaa
gccaagaaggaggcagacgagaagaatcgggctttgaatgctttggcaaaaaatgatgtc
cggtacagaaaatataccatagaagaaattgaagaagctactgaaatgttctcagaatca
aataagattggagaaggaggttatggacctgtttataaaggcaaacttgatcacactcct
gttgccatcaaagttttacgacctgatgctgctcaaggaaagaagcaattccagcaagag
gttgaggttctttgcagcattagacacccaaacatggtccttctccttggcgcctgccct
gagtatggatgcctggtatatgaatacatgttcaatggcagcttagaggataggctattt
cgaaggggcaatactcgtccactttcctggaggaaacgatttaaaatagctgcagaaatt
gcaactgcccttctatttcttcaccaagcaaagccagaaccactagtgcatcgggacctt
aagccagctaacattcttatagaccgtaattatgtgagcaaaattagtgatgttggccta
gcacggctagttccaccttctgtagctgacagtgtaacacaatatcacctgacttcagca
gcagggacattctgttacatagatcctgaatatcaacaaacaggcatgctaacaactaaa
tcagacatatattccctcggaataatgcttctccagataattacagccaagcctccaatg
ggtattgctcatcatgttggaaaggccattgaaaaaggaacttttgccgatatgcttgat
ccaactgtgccagattggccagttgaagaggctttatcatttgctcaattggcactgaag
tgtgtagagctgaggaagagggatagaccagatcttggcactgttatagtgccagaactt
aactggttaagagaccttggaatgagctctgactcacgtagccttggatacagcagtgat
ggttataccggacatagcagtggtggttatagccaaggatacagcggtgggggtcatagc
caaggacacaactatagtggtcatagtggcagccatgcacgttcttcagtaagtccactt
tcaaggtcgaggacatcatcagcaagtcaggaatcaatgagtaagactgaaaattcagaa
actgaacaaataccaaactctaaagaagatgaagttgaatga

DBGET integrated database retrieval system