KEGG   Durio zibethinus (durian): 111305353Help
Entry
111305353         CDS       T05242                                 

Definition
(RefSeq) tyrosine decarboxylase 1 isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00350  Tyrosine metabolism
dzi00360  Phenylalanine metabolism
dzi00380  Tryptophan metabolism
dzi00950  Isoquinoline alkaloid biosynthesis
dzi00965  Betalain biosynthesis
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111305353
   00360 Phenylalanine metabolism
    111305353
   00380 Tryptophan metabolism
    111305353
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    111305353
   00950 Isoquinoline alkaloid biosynthesis
    111305353
   00965 Betalain biosynthesis
    111305353
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dzi04147]
    111305353
Enzymes [BR:dzi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     111305353
    4.1.1.105  L-tryptophan decarboxylase
     111305353
Exosome [BR:dzi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111305353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 111305353
NCBI-ProteinID: XP_022758544
Position
Unknown
AA seq 489 aa AA seqDB search
MEKRLKPMDAEQLREYGHKMVDFIADYYKTIENFPVLSQVEPGYLRNLLPDSAPNQPDSF
QHVLDDIQAKILPGVTHWQSPNYFAYYPSNSSVAGFLGEMLSAGLNIVGFSWITSPAATE
LEMIVLDWLAKMLKLPEDFLSAGQGGGVIQGTASEAVLVVLLAARDKALRRVGKGALEKL
VVYASDQTHSALQKACQIAGIHPENCRLLKANSSTNYALSPELLSETISQDLAIGLIPFF
LCATVGTTSSTAVDPLLALGKFAKSNEMWFHVDAAYAGSACICPEFRHYIDGVEEADSFN
MNAHKWFLTNFDCSALWVKDRSALVQALSTNPEFLKNKASQANMVVDYKDWQIPLGRRFR
SLKLWMVLRLYGLENLQCYIRSHIKLAKHFEDLVAQDTRFEVVTPRIFSLVCFRLLPPSN
GEYHGNKLNHELLDAVNSTGNVFISHTVLSGKYILRFAVGAPLTEEKHVNAAWKVLQDKA
TALLGESLR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagattgaagccaatggatgctgagcagctgagagaatatggtcacaagatg
gttgatttcattgctgattattacaaaaccattgagaatttccctgttctcagccaagtt
gagccaggatatcttcgtaatctgttaccggattctgcacctaatcaaccagattcattt
cagcatgttcttgatgacattcaagcaaagatattgccaggggttactcattggcagagt
ccaaattattttgcatactatccatccaatagcagcgttgctggatttttgggagaaatg
cttagcgctggtcttaatattgttggattcagttggattacatcccctgctgcgacagag
cttgaaatgattgttttagactggcttgctaagatgcttaagctacctgaagacttcctt
tcagcaggacaaggtgggggagtgatacagggtacggcaagtgaagctgttctagttgta
ctattggctgctcgtgacaaggccttgaggagggttggaaaaggtgcacttgaaaagctt
gtagtttatgcttctgatcaaacacattctgccttgcaaaaggcctgccagatagcagga
atccatcctgagaattgtaggctgctaaaagcaaactcttctacaaactatgcactttct
ccagagttgctgagtgaaacaatttcacaggaccttgctattgggttgattcctttcttt
ttatgtgccactgttggcactacttcatcgactgctgttgatcctttgcttgcactagga
aaatttgctaagagtaatgaaatgtggttccatgtggatgctgcatatgctggaagtgct
tgcatttgtccagaatttcgtcattacattgatggagttgaagaggctgattctttcaac
atgaatgctcataagtggtttctaactaattttgattgttcagcactctgggtaaaggat
agaagtgcattggttcaggccctctctacaaatccagagtttctgaagaataaggcttct
caagcaaacatggttgtagattacaaagattggcaaattcctcttggacgtcgatttaga
tcactgaaactatggatggtgttacgactgtatggcttggaaaacctgcagtgctatata
agaagccatatcaagttggccaaacattttgaggacctggttgctcaagacacaagattt
gaggttgtcacccctcggatattttcattagtctgttttcgccttttgcctccttctaac
ggtgaatatcatggtaacaaattgaaccatgaactattagatgctgtaaactcaacaggg
aatgtcttcatatctcacacggttttatcaggcaaatacatactacggtttgccgtaggt
gccccattgactgaagaaaagcatgtgaatgcagcatggaaagttttgcaagataaggcc
actgccttgctaggggaatccttacgataa

DBGET integrated database retrieval system