KEGG   Durio zibethinus (durian): 111305533Help
Entry
111305533         CDS       T05242                                 

Definition
(RefSeq) indole-3-glycerol phosphate synthase, chloroplastic-like
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
dzi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    111305533
Enzymes [BR:dzi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     111305533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS ThiG
Motif
Other DBs
NCBI-GeneID: 111305533
NCBI-ProteinID: XP_022758904
Position
Unknown
AA seq 389 aa AA seqDB search
MEGLISLKTTPGISSQSIPSFNHPPNFFLRRSSMDLPLRRSNFFAIRAHQSDTVSPKKEE
DEDALKVKEWEVGMFQNEVAASQGIRIRRRPPTGPPLHYVGPFEFRLQNEGNTPRNILEE
IVWHKDMEVSEMKGKKPLAALKKVIENAPPTRDFVGALKAAHSRAGLPGLIAEVKKASPS
RGILRENFDPVEIARAYEKGGAACLSVLTDEKYFKGSFENLEAIRNAGVKCPLLCKEFVI
DAWQIYYARIKGADAILLIAAVLPDLDIRYMIKICKMLGLAALVEVHDEREMDRVLGIEG
IELIGINNRNLETFEVDISNTKKLLEGERGQMIRQKDIIVVGESGLFTPDDVAYVQEAGV
RAVLVGESIVKQSDPGKGITGLFGKDISL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggagggattgatttccctgaaaacaactcctggaatttcctcccaatcgattccttcc
tttaatcacccacctaatttcttcctcagacgctcctcaatggatcttcctctccgtcgc
tccaattttttcgccattcgagcccatcagtcggatacggtatctccgaaaaaggaagag
gatgaagatgctttaaaagtaaaggagtgggaagttggaatgttccaaaacgaagtcgca
gccagtcaaggaataagaattcggcgacgcccaccgacaggtccgccgttgcattacgtg
ggtccgttcgagttccgtttgcagaacgagggtaacactcctcgtaacattctcgaagaa
atcgtttggcacaaagatatggaagtttccgaaatgaaagggaagaagcctttggctgcg
ttgaagaaggttattgagaatgcacctccgactagagatttcgttggggctcttaaggcg
gctcattcgcgggctggattgcctggtttaattgctgaagttaagaaggcttctcctagc
agaggaattctcagagagaattttgatcctgttgagattgcaagggcatatgagaagggt
ggagctgcttgtcttagtgttttgaccgatgaaaagtattttaagggaagctttgaaaat
ttggaggcaataagaaatgctggagtaaagtgtcctctactgtgcaaagaatttgtgata
gatgcatggcagatctattatgctcgaatcaaaggagcagatgcaatacttttaattgct
gctgttttgcctgatcttgacatcagatacatgattaaaatctgcaagatgcttggtttg
gcagctcttgtagaggtgcatgatgagagggaaatggatcgtgttcttggtatagagggt
attgaacttattggtatcaataatcgtaaccttgaaacatttgaggtagatatcagtaac
acaaagaagcttcttgaaggagagcgtggccaaatgatccgtcagaaagatataattgtt
gtaggagaatcagggctatttactccagatgatgttgcttacgtgcaagaagctggtgtt
agagctgttttggttggggagtcgatagtgaagcaaagcgaccctggaaaaggaataact
ggactttttggtaaagacatttctttgtga

DBGET integrated database retrieval system