KEGG   Durio zibethinus (durian): 111305544Help
Entry
111305544         CDS       T05242                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase 1, chloroplastic-like isoform X1
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00030  Pentose phosphate pathway
dzi00480  Glutathione metabolism
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
dzi01200  Carbon metabolism
Module
dzi_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
dzi_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    111305544
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111305544
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dzi04147]
    111305544
Enzymes [BR:dzi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     111305544
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     111305544
Exosome [BR:dzi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   111305544
  Exosomal proteins of colorectal cancer cells
   111305544
  Exosomal proteins of bladder cancer cells
   111305544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 111305544
NCBI-ProteinID: XP_022758919
Position
Unknown
AA seq 591 aa AA seqDB search
MATHITPCSSSSSSSSLTFSSEFNVCKPRKCCFSKRVSQVRPRILSRNHFQIKSSNGQPL
NAVSMQDVLFGLGMDGRPLAKGIKPEEEEVFFDFSDPEEVQSTLSIAVVGASGDLAKKKI
FPALFALYYEDCLPENFVVFGYARTKLTDEELRNMISGTLTCRIDTNENCEAKMEQFLKR
CFYHSGQYNSEEHFAELDSKLKEKEAGKLSNRLFYLSVPPNIFVDVVRCASLKASSANGW
TRVIVEKPFGRDSESSAELTRCLKRYLTEDQIFRIDHYLGKELVENLSVLRFSNLVFEPL
WSRNYIRNVQLIFSEDFGTEGRGGYFDHYGIIRDIMQNHLLQILALFAMETPVSLDAEDI
RNEKVKVLRSMKQLQLEDVIIGQYKGHNKGGRRYPGYTDDSTVPNNSITPTFAAAALFIN
NARWDGVPFLMKAGKALHTRRAEIRVQFRHVPGNLYKQNFGTDLDKATNELVLRVQPDEA
IYLKINNKVPGLGMRLDRSDLNLLYRARYSKEIPDAYERLLLDAIAGERRLFIRSDELDA
AWSLFTPLLKELEVKKIAPELYPYGSRGPVGAHYLAAKYNVRWGDLSGEDS
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctacacacattacgccttgttcttcttcttcttcttcttcctcacttaccttttct
tctgaattcaatgtttgtaagccaagaaaatgttgtttctccaaacgggtttctcaagtt
cgtccaagaatcctttcgagaaaccatttccagatcaaatcctcaaatgggcagccacta
aatgctgtttctatgcaggatgtgctctttggattaggtatggatggaaggcctttggcc
aaaggaatcaagcctgaagaggaagaagttttctttgacttctcagacccagaggaagta
cagtctactctcagcatagctgttgttggagcttcaggggaccttgctaagaagaaaatt
tttcctgcactttttgccctttactatgaagattgtcttcctgagaactttgtggttttt
ggttatgctcgtactaaactgacagatgaagagctcaggaacatgattagtggaacttta
acttgtagaattgatacgaacgaaaattgtgaagctaaaatggagcagttcttgaagaga
tgcttttaccattcaggtcagtataattctgaggagcattttgcagaactagatagcaag
ctgaaagagaaagaggctggaaaactgtcaaataggttattttacttgtcagtacctcca
aacatatttgtggatgtggtgagatgtgccagcctcaaagcctcttcagcaaatgggtgg
acaagggtcattgttgaaaagccatttggccgtgattcagagtcctctgctgagctaaca
agatgtctgaagcgttatttaactgaggatcagatcttcaggattgaccattacttgggc
aaggaacttgttgagaatctctcagtgcttcgcttctcaaatcttgtttttgaacctttg
tggtcaaggaattatatccgcaatgtgcaattgatattttctgaagactttggtactgaa
ggacgagggggttattttgatcattatggaatcatacgagatataatgcaaaatcatctc
ctgcaaattctggcactgtttgcaatggagactcctgtcagcttagatgctgaggacatt
aggaatgaaaaggtaaaggttctgagatcaatgaaacaactgcagctcgaggatgtcatc
attggtcagtataagggccacaacaagggcggtagaagatatccaggttatactgatgac
tcaactgtaccaaataacagtattacgcctacatttgctgcagcagctctgtttataaat
aatgcaagatgggatggtgtcccttttctcatgaaggccggcaaagctctccatactagg
cgggcagaaatcagagttcagtttagacatgttccaggtaatttgtacaagcagaatttt
ggaactgatttggacaaggctacaaatgagcttgtgctgcgcgtgcaacctgatgaagcc
atttatctgaagatcaataacaaagttcctggtcttggaatgagattagatcgcagtgac
cttaatttgctttatcgggcaaggtattcaaaagaaatcccagatgcatatgagagattg
ctcttagatgctatagcaggggaacgaaggttgttcattagaagtgatgagctagatgct
gcttggtcactgtttacaccattgctaaaagaactcgaagtaaaaaagattgctccagaa
ctgtacccgtatgggagcagaggaccagttggagcacattatcttgcggccaagtacaat
gttcgatggggtgatctcagcggagaagactcataa

DBGET integrated database retrieval system