KEGG   Durio zibethinus (durian): 111306650Help
Entry
111306650         CDS       T05242                                 

Definition
(RefSeq) MDIS1-interacting receptor like kinase 2-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
dzi  Durio zibethinus (durian)
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dzi01001]
    111306650
Enzymes [BR:dzi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111306650
Protein kinases [BR:dzi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111306650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PIP49_C Pkinase_fungal APH RIO1 Fructosamin_kin
Motif
Other DBs
NCBI-GeneID: 111306650
NCBI-ProteinID: XP_022760170
Position
Unknown
AA seq 150 aa AA seqDB search
MKILHQSENNMISNNLKAFEREIHGLSEIRQRNIVKLYGFCSHPKNSFLVYEFVETGSLK
MVLRKKDEAMELDWEKRLNVVKGVAHALSYVHHDHSSPIIHRDISSNNVLLDLDYEAHVS
DFGTASLLKPDTFNWASLAGTFGYIVPGIY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacttcaccaatctgaaaataacatgatttccaacaacttgaaagcctttgaa
agagagattcatggtttatcagaaataaggcaacgtaacattgtgaagctgtatggcttt
tgttcacatccaaagaactcatttttggtttatgagtttgtagaaacgggaagtttgaaa
atggtgttaaggaaaaaggacgaggcaatggagttggattgggagaagaggttaaatgtt
gtaaaaggagtggcccatgccttgtcctatgtgcatcatgaccattcatcacctattatt
catcgagacatttccagcaacaatgttcttttggatttggactatgaggctcatgtctca
gattttggcacagccagtcttttaaagcctgatactttcaattgggcctcacttgctggc
actttcggatatatagttccaggtatttattga

DBGET integrated database retrieval system