KEGG   Durio zibethinus (durian): 111307547Help
Entry
111307547         CDS       T05242                                 

Definition
(RefSeq) aspartic proteinase oryzasin-1-like isoform X1
  KO
K08245  phytepsin [EC:3.4.23.40]
Organism
dzi  Durio zibethinus (durian)
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dzi01002]
    111307547
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.40  phytepsin
     111307547
Peptidases and inhibitors [BR:dzi01002]
 Aspartic peptidases
  Family A1: pepsin family
   111307547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N SapB_2 SapB_1 TAXi_C
Motif
Other DBs
NCBI-GeneID: 111307547
NCBI-ProteinID: XP_022761298
Position
Unknown
AA seq 549 aa AA seqDB search
MTFQHLILFSIYVIALLNMYMLFIRLMVKLFSYPMDTGYLVSMGDKFLLLVMCLLVSTFW
LAIASSSDGLVRLGLRKQRLGINSINAARIKGTDSAYAKGEVTTTRGSDDSAMNIVSLKN
YLDVQYFGEVGIGSPPQKFTVIFDTGSSNLWIPSSHCYFSVACFFHSRYNSSKSSTYTEI
GKPCKINYGSGMILGFFSEDNIKVGGLVVKNQVFTEAIREGSLILSLASFDGILGLGFQD
ISVGNVAPLWYSMMEQSLVAQKVFSFWFNKDPSASEGGEIVFGGVDQKHFKGKHTYVPVI
RKGYWQIELADFLIADKSTGFCTNCTAIVDSGTSFIAGPKAAVTKMNHAIGAKGFVSMEC
KKVVAQYGDLMWQLLLSGLQPDKLCSNIGICSYNRTQKMSETIEMVVEQKREKHTEVGQD
LLCTACELTLAWIRTELTQNKTEGRVIEYVNKLCDNLPNPTRELAVDCEKIPNMPTVSFI
IGNKSFHLTPEQYIRRVEQNFSTFCVSSFIALDIPPPQGPLWILGEIFMEAYHTVFDFGN
LRVGFAEAV
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcaacatcttattcttttttctatatatgtgatagcattattgaatatgtat
atgctatttattcgtctgatggtaaagttattttcttacccgatggacacaggatacctt
gtatcaatgggggataagtttcttttactggtaatgtgtttattggtatctacattctgg
ttggctattgcttcctcctcagatggtctggtgagactaggtctaaggaaacagcgctta
ggcattaacagtataaatgccgctagaattaaagggacagacagtgcatatgctaaggga
gaagtaacaactactcgtggctcagatgattcagcaatgaatatagtttccctgaagaac
tatttggatgttcagtattttggagaagttggaattggttcaccaccacagaagttcact
gtcatctttgatactggcagttccaacctatggattccatcttcacattgttatttttcc
gttgcttgctttttccactctagatacaactctagcaagtcaagtacatacacggagatt
gggaaaccttgcaaaatcaattatggttctggaatgattttgggcttcttcagtgaagat
aatataaaagttggaggccttgttgtcaaaaatcaagtatttacagaagccataagagaa
ggaagtcttattctttctttggcaagttttgatgggatacttggacttgggtttcaggac
atttctgtggggaatgtggctccgctttggtacagtatgatggaacaaagcctagttgct
cagaaggtattctccttctggttcaacaaagatccatcggccagcgaaggcggtgagatt
gtctttggtggtgttgatcagaagcacttcaagggaaagcatacttatgtcccggtcatt
cggaaaggttattggcagattgaattggcagattttttaattgcagacaaatccacagga
ttttgcaccaactgcactgctatagtggattcaggcacgtccttcattgctggccccaaa
gctgctgtgacaaaaatgaatcatgctattggagcgaaaggatttgtgagcatggaatgt
aaaaaagtggttgctcagtatggcgatctgatgtggcagctcttgttatcagggctacag
cccgacaaattatgttccaatattggtatatgctcctacaataggactcaaaaaatgagt
gaaactattgaaatggtggtagaacaaaagagagagaagcacacagaagtcggccaggac
cttctatgcactgcttgtgagttgactttagcatggataaggacagagcttacgcaaaac
aaaacagaaggaagagtaattgaatatgtgaacaagttgtgcgataacctaccaaatccc
acaagagaactagctgttgattgtgaaaaaataccaaacatgccgactgtttcatttatc
attgggaataaatccttccaccttactcccgagcagtacatccgcagagtggaacaaaat
ttctctaccttctgcgtcagtagctttattgcattggatattcctcctcctcagggtcct
ctctggattcttggggaaatcttcatggaagcatatcacactgtgtttgattttggtaat
ctccgagtaggatttgcagaagctgtttag

DBGET integrated database retrieval system