KEGG   Durio zibethinus (durian): 111309087Help
Entry
111309087         CDS       T05242                                 

Definition
(RefSeq) bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic isoform X1
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00740  Riboflavin metabolism
dzi00790  Folate biosynthesis
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
Module
dzi_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    111309087
   00790 Folate biosynthesis
    111309087
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     111309087
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     111309087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 SWM_repeat
Motif
Other DBs
NCBI-GeneID: 111309087
NCBI-ProteinID: XP_022763670
Position
Unknown
AA seq 561 aa AA seqDB search
MASFNISSPSTAAVSRPQASKSFKFFNGLHSTNLFSANGYTSDLALIRLGNRSSFVIKSV
GKTRAALVSGEGGLLSYSNGNGASTNGTLFSDKSVGIEAQQDAIAFGTLAADTALISNGF
PIYNDEFDLDRPTEGFASIPEAIEDIRQGKMVVVVDDEDRENEGDLIMAAQLATPEAMAF
IVKHGTGIVCVSMQEQDLDRLQLPLMVHQRENEEKLRTAFTVTVDAKHGTTTGVSAHDRA
TTVLALASKVSKPEDFNRPGHIFPLKYREGGVLKRAGHTEASVDLAMLAGLDPIAVLCEV
VDDDGSMARLPKLHQFAERENLKIISIADLIRYRRKRDKLIDRAGAARIPTMWGPFTAYC
YRSILDGIEHIAMVKGEIGDGQDILVRVHSECLTGDIFGSARCDCGNQLGLAMKQIEAAG
RGVLVYLRGHEGRGIGLGHKLRAYNLQDAGRDTVEANEELGLPVDSREYGIGAQILRDLG
VRTMKLMTNNPAKYSGLKGYGLAIAGRVPLLTPITKENKRYLETKRAKMGHVYGLDFNGR
LNSLIIGGNGNTIAADAASES
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttcaacatttcttctccttcaacagcagctgtttctcgacctcaggcatcc
aaaagcttcaaattctttaatggattacacagcacaaatctattctctgcaaatggatac
acatctgatttggccttgatacgattgggtaatagatcatctttcgttattaaaagtgtt
ggcaaaactagagctgcacttgtatctggagagggcggcctcctgtcttattccaatggc
aatggtgcttcaacaaatggtactctcttcagtgataaatcagttgggatcgaagcacaa
caggatgcaatagcatttggaactcttgcagcagatactgctcttataagtaatggtttt
cccatttacaatgatgagtttgatttggatcgtcccactgaaggttttgcttccatccct
gaggcaattgaggacattcgccaaggcaagatggtagtggttgtagacgatgaggacaga
gaaaatgaaggagatctaataatggcagctcagttggcgacacctgaggctatggccttt
attgtgaagcatggaactgggatagtttgtgtgagcatgcaagagcaggatctggatagg
ttgcagcttcctttgatggtgcaccaaagggaaaatgaagagaaactccgcactgcattc
acagttacagtagatgcaaaacatggtactacaactggggtgtcagctcatgatagggca
acaacggtattggccctcgcttctaaagtttccaaacctgaggatttcaaccgcccaggt
catattttcccactgaaatacagggaaggtggtgttctgaaaagagctgggcatactgaa
gcttctgttgatcttgcaatgctagctggattggaccctattgcagttctctgtgaggtt
gtagatgatgatggatccatggctagattaccaaagcttcatcaatttgctgagcgggag
aacttgaaaattatatccattgctgatttaatcaggtataggagaaagagagataaatta
attgatcgtgctggtgctgcacggatacctactatgtgggggccattcacggcctattgt
tacaggtcaatattagatgggattgagcatatagcaatggtaaagggtgagattggagat
gggcaagatattcttgtgagggtccactcggaatgcctcacaggagacatatttggatct
gctagatgtgactgtgggaatcagcttggccttgcaatgaaacagattgaggctgctggc
aggggtgttttggtataccttcgtgggcatgaaggcaggggtattggtttgggccacaag
cttcgtgcctataatcttcaggatgctggtcgtgatacagttgaagcaaatgaggagctt
ggattgcctgtggattcgagagaatatggcatcggtgcacagatacttagggacctgggt
gtgcgaacgatgaaactgatgacaaacaatcctgccaaatacagtggactcaagggttat
ggattagcaattgcaggcagggttccgctactaactcctattacaaaggagaataagaga
tacttggagacgaaacgcgctaaaatgggccacgtttatggcttagactttaatggcagg
ttgaacagtctcattattggcggcaacggtaacacgattgcagcggatgctgcatctgaa
tcttaa

DBGET integrated database retrieval system