KEGG   Durio zibethinus (durian): 111309215Help
Entry
111309215         CDS       T05242                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial-like
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00020  Citrate cycle (TCA cycle)
dzi00640  Propanoate metabolism
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
dzi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111309215
   00640 Propanoate metabolism
    111309215
Enzymes [BR:dzi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     111309215
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     111309215
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 111309215
NCBI-ProteinID: XP_022763923
Position
Unknown
AA seq 351 aa AA seqDB search
MTRRASRLIHFLSSKISSHKLQISPLSLFSSSSSSSSSHFLTQSRSFSAAPAPPPAVFVD
KNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKA
NASVIYVPPPFAAAAIMEGMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCP
GIIKPGECKIGIMPAYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTSVGIGGDPFNG
TNFIDCVTKFLADPQTEGIILIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRR
MGHAGAIISGGKGTAQDKIKTLREAGVTVVESPAKIGVAMLDVFKQRGLVN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgactagacgagcctcacgactcatccattttttgtcttccaagatttcttctcacaag
ctccaaatatccccactcagtctcttctcctcctcttcctcttcctcttcttctcatttt
ttgactcagtcacggtctttctcggcggctccagcgcctccacctgcggttttcgtagac
aagaacactcgcgttatttgccaaggcataactggaaagaatggcactttccacaccgag
caagccatcgaatatggcactaagatggttggtggagttacaccaaagaagggtggcaca
gagcacttaggacttcctgttttcaacacagttgccgaagcaaaggctgaaaccaaggct
aatgcttctgtcatttatgttcctccaccttttgctgcagctgctatcatggagggtatg
gaagctgaattggatcttgttgtttgtatcacggaagggattcctcaacatgacatggtt
cgtgtgaaggctgcccttaatcagcaatcaaaaactaggttgattggtccaaactgccct
gggatcattaaacctggggaatgcaagattggaattatgcctgcatatattcacaaacca
ggtcgcataggaattgtttctcgatcgggcactttaacatatgaagcagttttccaaaca
actgcagttggtctggggcaatcaacctctgtcggaattggtggggatccttttaatgga
accaacttcattgattgtgtgacaaaattccttgctgatcctcagacagaaggtatcatt
ctaattggtgagatagggggcaccgcagaagaagatgctgctgcactaataaaggaaagt
gggactgaaaagcctattgttgccttcattgctggacttactgctcctccgggacggcgt
atgggtcatgctggagcaattatatccggaggcaagggcacggctcaggacaaaatcaag
actctaagggaagctggagtgacagttgttgaatcacctgcaaagattggtgtggcaatg
cttgatgtcttcaagcaaagaggtctcgtgaattag

DBGET integrated database retrieval system