KEGG   Durio zibethinus (durian): 111310006Help
Entry
111310006         CDS       T05242                                 

Definition
(RefSeq) serine/threonine-protein kinase GRIK2-like
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
dzi  Durio zibethinus (durian)
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dzi01001]
    111310006
Enzymes [BR:dzi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     111310006
Protein kinases [BR:dzi01001]
 Serine/threonine kinases: Other
  CAMKK family
   111310006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 Kinase-like APH WaaY Seadorna_VP7 Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 111310006
NCBI-ProteinID: XP_022764819
Position
Unknown
AA seq 170 aa AA seqDB search
MRMTQSETAMTNVLREVSIMKMLDHPNIVNLVEVIDDQRSDYLYMVLEYVEGNHIRNLSE
IQGHIDETAARRYFKDIIAGLIYLHSHNIVHGDIKPENLLLTKGGSVKIGDFSVSQAFED
DNDELWRCPGTPAFTPPECCLSMYISLIHMVFSLQVLLLRNFTMNSLKFF
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgcggatgacacagtcagaaacagcaatgaccaatgttctcagagaggtttcaataatg
aagatgttggatcatccaaacatagtcaaccttgtggaagtaatagatgaccaaagatct
gattacctctatatggttcttgagtatgtggaaggtaatcatataagaaacctttctgaa
atccaaggacacattgatgagacagctgcaaggagatacttcaaagatataattgcaggt
ctcatttatttgcatagtcataatatcgtgcatggtgatataaagcccgaaaatcttctg
ctcacaaaagggggaagtgtgaaaattggtgatttcagtgtgagtcaggcttttgaggat
gacaatgatgagctgtggagatgccctggaactccagcttttactccacctgagtgctgc
ttgagtatgtacattagtttgattcatatggttttttcattacaagtattacttttaaga
aactttaccatgaacagtctaaaatttttttga

DBGET integrated database retrieval system