KEGG   Durio zibethinus (durian): 111310038Help
Entry
111310038         CDS       T05242                                 

Definition
(RefSeq) tRNA (guanine(26)-N(2))-dimethyltransferase isoform X1
  KO
K00555  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase [EC:2.1.1.215 2.1.1.216]
Organism
dzi  Durio zibethinus (durian)
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dzi03016]
    111310038
Enzymes [BR:dzi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.215  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase
     111310038
    2.1.1.216  tRNA (guanine26-N2)-dimethyltransferase
     111310038
Transfer RNA biogenesis [BR:dzi03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    111310038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRM DUF2067 Rrf2
Motif
Other DBs
NCBI-GeneID: 111310038
NCBI-ProteinID: XP_022764862
Position
Unknown
AA seq 430 aa AA seqDB search
MSILNLNPKSLSPSLFIHKTFTNPKRSSISHQISIFKPPIYCKSNQITERGILFDTGDTF
FRHESATGRDLGVLSAALYKQSKGQLRVLDAMCGCGIRSLRYLIESKADFVLANDANESH
RRVILENLAQVERLQGQNKRWVITHWEANRVLTDCYLQRDYFDYIDIDSFGSDSSFFLRA
AFNSLKLDGLVYVTSTDGYSSGGHRPYHSLATYGAYVRPMPYANELGLRILIGGAVREAS
VLGYRVTPLFSYYSYHGPVFRVLLRMNRGKLPDNRDYGFICYCNCCGNSQAVSWSELGQI
RCPCSNTKDAASLVVSGPLWTGPLHSAAYIMEMLNLAEQWGWVGDGAGTDLEKLLKRMLE
ESDPRLPFGYIKLDEVASRAQTNTPSISTIMSTLRKEGYAASRSHIASNAIKTNCPMAVC
IRIAKELHGC
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatactcaatctcaatcctaaaagcctatccccttctctttttatccacaaaacc
tttacaaaccctaaaaggtcctcaatttcacaccaaatttcaatctttaagcccccaatt
tactgcaaatccaatcaaataaccgaaaggggcatcctttttgacaccggagacaccttt
ttccgccacgaaagcgccacaggccgagacctcggggtcctctcagcagcactctacaag
caatccaaaggccaattaagagtcctcgatgcaatgtgcggctgcggaatccggtccctt
cgctacctcatcgaatcgaaagccgatttcgtgttagccaatgatgcaaacgaaagccac
aggagggttattttggagaatttagcacaagttgaaaggcttcaagggcaaaacaaaaga
tgggtaatcacgcattgggaagccaaccgggttttaacggattgttatttgcaaagggat
tattttgattatattgatatagattcctttggaagtgattcgtctttctttttaagggct
gcttttaatagtttgaaacttgatgggttggtttatgttacttccactgatggctattca
tctggaggtcaccgcccttaccattcattagcaacatacggagcatatgttcgtccaatg
ccgtatgcaaatgagcttggtttgcgaatccttataggtggtgctgtgagggaggcttct
gtactgggatatcgtgttaccccacttttttcatactactcttaccatggacctgttttc
agggtcttgctccgaatgaatcgagggaagctacctgacaacagggattatggtttcatc
tgctactgtaactgctgtggaaattctcaagcagtttcatggagtgaacttggtcaaatc
agatgtccctgcagtaacacaaaagatgctgcatcacttgttgtatcaggccctctgtgg
acaggacctcttcatagtgctgcttatatcatggaaatgttaaatttggctgagcagtgg
ggatgggtgggcgatggtgcagggactgatctagaaaagctgctgaaacgaatgttggaa
gaaagtgaccccagattaccatttgggtacataaaattagatgaggtggctagtcgtgca
caaacaaatactccttctataagtactatcatgagcacccttcgcaaggagggatatgct
gcaagtagatctcacattgcctccaatgcaatcaagacaaactgtcctatggcagtgtgc
atcaggattgccaaggaattacatggttgctga

DBGET integrated database retrieval system