KEGG   Durio zibethinus (durian): 111310424Help
Entry
111310424         CDS       T05242                                 

Definition
(RefSeq) sucrose-phosphatase 2-like isoform X1
  KO
K07024  sucrose-6-phosphatase [EC:3.1.3.24]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    111310424
Enzymes [BR:dzi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.24  sucrose-phosphate phosphatase
     111310424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S6PP S6PP_C Hydrolase_3 PMM
Motif
Other DBs
NCBI-GeneID: 111310424
NCBI-ProteinID: XP_022765605
Position
Unknown
AA seq 423 aa AA seqDB search
MERLNGPARLMIVSDLDFTMVDHEDPENLSLLRFNALWEAYYRQDSLLVFSTGRSPTIYK
QLRNEKPLLTPDITIMSVGTEIAYGESMVPDYGWVQCLNLNWDRDIVIQETAKFPQLIPQ
SDTEQRPHKVSFFLEKPKSLEVIKALAERLDKRWLDVKIIYSNGTALDVLPKGAGKGQAL
AYLLRKFKADGRMPLNSLVCGDSGNDAELFTIPEVYGVMVSNAQEELLQWHAENAKNNPN
IIHASERCASGIIQAISKFTLGPNVSPRDIRDLRKCRVNNFSPGHEVVKFYLFYERWRRA
ELEKSDQLMQNLKSSFYPLGTFVHPSGTEQLMINCIDMMQRSYGDKQGKQYCVWLDRVSA
AQIGSDAWLVKFDKWESTGEKRQSCLTTVLLTTKQAEDAFTWMHIHQTWLNGLEAKDQTT
WYF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaacgtctcaatggtcctgcccgtctcatgatagtttcagatctcgattttacaatg
gttgatcatgaagacccagaaaacctttctcttcttcggttcaatgccctttgggaggcc
tattatcgccaggattctttgctggtgttttccactggaaggtcacctacaatttataaa
cagctgaggaatgagaagcccctgttgaccccagatataactatcatgtctgtgggaact
gagattgcttatggtgaatcaatggtacctgattatggttgggtacaatgtttgaacctc
aactgggaccgtgacattgttattcaggaaacagcaaagtttcctcagcttattccgcag
tcagatacagagcaacgacctcacaaggttagctttttcctggagaaacctaagtcatta
gaagtaatcaaggcacttgcagaacgtttagacaaacgctggttagatgttaaaataata
tatagcaatgggacagctttagatgtattaccaaaaggtgctggtaaaggacaagctctt
gcatatttgctgagaaagtttaaagctgatggaagaatgccacttaattcacttgtttgt
ggtgactctggaaatgatgctgaactattcaccattcctgaagtatatggtgtgatggtt
agcaatgcacaggaagagttattacaatggcatgcagaaaatgcaaaaaacaatcctaac
ataatccatgctagtgagagatgtgcatctggaataatacaagccatcagtaaatttact
ttaggtccaaatgtgtctcccagagatattagagacttaagaaaatgcagagtaaataat
ttcagtcctggtcatgaagtggtgaagttctatttattttatgagagatggcgacgtgca
gaacttgagaagtctgatcagcttatgcaaaatctaaaatcaagcttttatccattaggt
acttttgtccatccctctggaactgagcaactgatgatcaactgcatagatatgatgcaa
aggtcatatggggataaacaaggaaagcaatattgtgtttggctggatcgggtttcagca
gcacagattggctcagatgcatggctggtgaagtttgataaatgggagtcaactggtgaa
aagagacagtcctgtcttaccactgtcttgcttactacaaagcaagctgaagatgccttc
acatggatgcacatacatcagacatggttgaatggtttggaagcaaaggaccaaactact
tggtatttctag

DBGET integrated database retrieval system