KEGG   Durio zibethinus (durian): 111310992
Entry
111310992         CDS       T05242                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00100  Steroid biosynthesis
dzi01100  Metabolic pathways
dzi01110  Biosynthesis of secondary metabolites
Module
dzi_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    111310992
Enzymes [BR:dzi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     111310992
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 111310992
NCBI-ProteinID: XP_022766107
UniProt: A0A6P6AMK1
Position
Unknown
AA seq 369 aa
MDLGFLLKALIPSWNSVAVLMIFFAYLAVAGSILPGKLVPGVTLQDGSRLHYCCNGLLAL
LLLVGLLGVGSKVNFVSPTVISDGGLELLSATFIFSFLAMMVLYAAGCRSQSKRSSLKPH
ITGNPIHDWWYGMQLNPQFMGIDLKFFFVRAGMMGWLLINLSILAKSVQDGTLSQSMILY
QLFSVLYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLNNKVEMT
TAAAIANCFVFLIGYLVFRGANKQKHIFKKNPKALIWGKPPKVIGGKLLASGYWGIARHS
NYLGDLLVALSFSLPCGISSPIPYFYPIYLFILLVWRERRDEVRCAEKYKDVWAEYCRLV
PWRIFPYLY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggttttcttctaaaggccttaattccctcgtggaactctgttgctgttttg
atgatattctttgcttacttagctgttgctggatctattttacctggaaaacttgttcct
ggagtcaccttacaagatgggtctcgtctccattactgctgcaatggattgctagcacta
cttttgttagttgggcttcttggggttggatctaaggtgaatttcgtatcacccacggtg
atatcagacggaggacttgagctgttatcagcaactttcatattcagttttcttgcaatg
atggtactctatgctgctgggtgcaggtcccaaagtaaacgttcttcattaaagcctcac
atcacaggaaacccgatacatgactggtggtatgggatgcagctgaatcctcagtttatg
ggtattgatctcaaattcttctttgttagagctggaatgatgggatggctacttatcaac
ctatcaattcttgcaaaaagtgttcaagatggcactttgagccaatcaatgatcctctac
caattattctctgtgctatacatcctggactattttgttcacgaagagtacatgacctcc
acctgggacataattgctgagagattgggtttcatgttggtctttggagatctagtgtgg
attcctttcacatttagcatccagggttggtggcttttgaataacaaagtggagatgaca
acagctgctgcaatagcaaattgttttgtttttctgattggctaccttgtatttagagga
gccaataagcaaaagcatatattcaaaaagaatcccaaggcgcttatatggggtaagcct
ccaaaggttatcggaggaaagctgcttgcttctggatattggggaattgcaaggcactct
aattaccttggggatttgttggtggcattgtccttcagtttaccttgtggaataagttcc
cccattccatacttctacccgatttatctgttcattctgttggtatggagggaaaggaga
gatgaagtccgttgtgcagagaagtacaaagacgtatgggctgaatactgcaggcttgtt
ccatggagaatatttccgtatctgtattag

DBGET integrated database retrieval system