KEGG   Durio zibethinus (durian): 111311306Help
Entry
111311306         CDS       T05242                                 

Definition
(RefSeq) serine/threonine-protein kinase-like protein At1g28390
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
dzi  Durio zibethinus (durian)
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dzi01001]
    111311306
Enzymes [BR:dzi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111311306
Protein kinases [BR:dzi01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111311306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo VapB_antitoxin
Motif
Other DBs
NCBI-GeneID: 111311306
NCBI-ProteinID: XP_022766414
Position
Unknown
AA seq 502 aa AA seqDB search
MGYLACNAESAVAVCDPYNWDYCHRGKSKKNKPRKTKNNVEIRQFRYTDLLSATNDFSSD
SFLGKGSHGSVYRAVLDDGKLIAAVKKTTINCSSPADNEIEILSRVYDPRLVNLIGYCSD
TLSRNKLIVVEYMPNGSLYDLLHSSSRPPGWSMRVRFALHVAKAVQALHSANPPVIHRDI
KSSNVLIDHNWNARLGDFGLALRGNVEDVRVKSTPPAGTLGYLDPGYLAPSDVSTKSDLF
SYGILLLEIISGRHAIDFNYSPPSVVDWAVPLIKGGDFAAICDGRVRPPVDKEVIRSLAV
LAAKCVRSTAEKRPGVAEVVECLKLVRKRVYAGPVWRNLRRRVKRVDKPLVKNQVFEGSE
EVVRGSRCGSRRNSRKVSSVNVDLNTDLISDRVVRSKSVGSFGGAAMMMKMGPTEIELDG
DHVALVNKRAGVTGKTPLVKLSKSRSMGVLQSRKLMNQNSKKYIFEIGKRRNSNEFDMSK
LVISFNDEKSERKMLENPLVLV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgggttacttagcttgcaacgcagagtcagccgtggccgtttgtgatccatacaactgg
gattattgtcatagaggaaaatccaagaaaaacaaacccagaaaaaccaaaaacaacgtt
gaaatcagacagtttcgctacactgatctcctttccgccaccaatgatttctcttccgac
agctttctaggcaaaggcagtcacggttctgtctacagagctgtcctagacgatggcaag
ttaatcgcagccgttaaaaagacgacaataaactgtagcagtcccgcagacaacgagatt
gagattctctcccgagtttatgatcctcgtctcgtcaatctcatcggttactgttccgat
accctttctaggaataaattaatcgttgtggaatatatgcccaacggttctttatacgat
cttttacattcttcttctagaccgccgggttggtccatgcgtgtacggttcgccttacat
gttgcaaaagcagttcaggctttgcattcggctaacccgcctgtaatccatagggatata
aaatcgtcaaatgttttgatcgatcataactggaacgcgaggttgggtgatttcgggctt
gcattaagaggaaacgtggaggatgtacgggttaagagcaccccaccggcggggacgtta
gggtatctcgacccgggttatttggcacctagtgacgtcagcactaaaagtgacttgttc
agttacggcattttgctattggagattatcagtgggagacatgccattgactttaattac
agtcccccatcggtagttgactgggcggtaccgttgatcaagggaggagatttcgcagca
atttgcgacggtcgtgtcaggccaccggtggataaggaggtgatcaggagtttggccgta
ttggcggctaagtgcgtcaggtccacagcggagaaacgccccggagtggccgaggtggtg
gaatgtttgaagttggtgaggaagagagtttacgcgggacctgtttggagaaatctaagg
cggcgcgtgaaacgagtggacaagccgttggtgaagaaccaggtgtttgagggtagcgag
gaggtggtaaggggttcaaggtgtggaagtcggagaaatagccgaaaagtatcgagtgtg
aatgtagatctcaacactgatttgattagcgatcgtgtggtgaggtcgaaatcggttggt
tcgtttggaggggcggctatgatgatgaagatgggacccacagagattgaattggacggt
gaccacgtggcattggtaaacaaaagggctggagtaacggggaaaacgccgctggtgaag
ctgagcaagtcaaggtctatgggagttttgcaaagtcggaaactaatgaatcagaacagc
aaaaaatacatattcgaaatcgggaaaagaagaaattcgaatgaattcgatatgtcaaaa
ttggttatcagttttaatgatgagaaatccgagagaaagatgttagaaaaccccttggtt
ttggtttag

DBGET integrated database retrieval system