KEGG   Durio zibethinus (durian): 111315616Help
Entry
111315616         CDS       T05242                                 

Definition
(RefSeq) biotin--protein ligase 1, chloroplastic-like
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00780  Biotin metabolism
dzi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    111315616
Enzymes [BR:dzi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     111315616
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     111315616
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     111315616
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     111315616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C
Motif
Other DBs
NCBI-GeneID: 111315616
NCBI-ProteinID: XP_022773208
Position
Unknown
AA seq 329 aa AA seqDB search
MDTTSHSTLFLCGKSSFETEIAKSLKINDALKLPNGGEVSTLLQSEINNFRFGEGTFNVE
LFLNSLSTNRFGRFLIWSPRLPSTHDIVSHNFCELPVGAVCVADVQFKGRGRSKNAWESP
GGCLMFSFTLQMEDGKIVPLVQYVVSLAVTEAIKDVCDRNGFPCLDVRIKWPNDLYLNGL
KVGGILCTSTYKSKKFNVSSGIGLNVGNEKPTTCLNAVLKELSTTSIEFRREYIMGAFFN
KFEMLYDIFINQGFQTLEELYYRTWLHSGQRVIIQEKNEDKVVENVVTIQGLTSSGYLLA
IGDDYQMCELHPDGNSFDFFKGLVRRKLV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggatacgacctcgcattctacgctgtttttatgcggcaaatcatctttcgaaaccgaa
attgccaaatcattgaaaatcaacgacgctcttaagctcccaaacggcggcgaagtttca
actcttttacaatcggagattaataatttccgattcggggaagggacttttaatgttgag
ttgtttttgaattcactctcgactaaccggttcggtcggtttcttatttggtctccgcgg
ttgccttccacgcacgacatcgtttctcataatttttgtgagcttccagttggtgcagtt
tgtgtagctgatgttcagtttaaagggcgaggtcggtccaagaacgcgtgggagtctccg
gggggatgccttatgttttcgtttacattacaaatggaggatggaaaaattgtgcctttg
gttcaatatgtggtgtctctcgctgtgacggaggctataaaggatgtttgtgatcgcaat
ggctttccatgtcttgatgttaggatcaagtggccaaatgatctgtacttaaatggcctt
aaagtgggaggcattctctgcacatcaacatataaatcaaagaagttcaatgtcagttct
ggtataggtttgaatgttggtaatgagaaaccaacaacatgcttgaatgcggtattaaaa
gagctttctactacttctattgaatttagaagagaatatattatgggtgccttctttaat
aaattcgagatgttatatgatattttcataaatcaaggatttcaaactcttgaggagctg
tactatagaacatggcttcatagtgggcagagagttattatacaggaaaagaatgaggac
aaagttgtggagaatgtggttactatccagggtttgacatcctctggatatttgttagct
attggggacgactatcaaatgtgtgagcttcatcctgatggaaacagttttgacttcttc
aaaggactggtcagaagaaaactcgtttga

DBGET integrated database retrieval system