KEGG   Durio zibethinus (durian): 111318798Help
Entry
111318798         CDS       T05242                                 

Definition
(RefSeq) thiamine thiazole synthase 2, chloroplastic
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
dzi  Durio zibethinus (durian)
Pathway
dzi00730  Thiamine metabolism
dzi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dzi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    111318798
Enzymes [BR:dzi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     111318798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 FAD_binding_2 DAO NAD_binding_8 Pyr_redox_2 GMC_oxred_N FAD_oxidored HI0933_like GIDA Lycopene_cycl NAD_binding_9 Pyr_redox_3 FAD_binding_3 RNA_pol_Rpb1_3
Motif
Other DBs
NCBI-GeneID: 111318798
NCBI-ProteinID: XP_022777400
Position
Unknown
AA seq 355 aa AA seqDB search
MAAMATTLTSLSSSPKPSFLDHKSSFHGTPIASRFTPIKSSSPNSTISMSLTPPYDLQSF
KFQPIKESYVAREMTRRYMMDMITYADTDVIIVGAGSAGLSCAYEISKNPNICVAIIEQS
VSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIPYDEQEDYVVIKHAALFTSTIMSKLLAR
PNVKLFNAVAAEDLIVKGNRVAGVVTNWALVSMNHDTQSCMDPNVMEAKVVVSSCGHDGP
FEATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAEIDGGPRM
GPTFGAMMISGQKAAHLALKALGQPNVIDGTFSEAERVQPEFVLAAAETEGTVGA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcagccatggcaacaaccctcacctcactgtcttcaagccccaaaccatctttctta
gaccacaagtcatccttccatggcaccccaattgcttctcgcttcactcccattaaatcc
tcctctccaaactccacaatttccatgtccttaactcctccttatgacttacagtccttt
aaatttcaacccatcaaagagtcctatgtcgctcgtgaaatgacacgccgttacatgatg
gacatgattacctatgctgacactgatgttatcatcgttggcgccggctctgcaggtctc
tcttgtgcttacgagattagcaaaaaccccaacatatgtgttgccataattgaacaatct
gttagccctggtggaggcgcatggcttggtggccaactattttcagctatggttgtccgc
aaaccagctcacagattccttgatgagcttggcatcccatatgatgaacaagaggactac
gtcgtgatcaagcatgcagctttgttcacatcaacaatcatgagcaagcttttggccagg
cctaacgtgaagttgttcaacgctgttgctgctgaggatttgatagtgaagggaaacaga
gttgccggagtggtaactaactgggctttggtgtctatgaaccatgacacacaatcttgc
atggacccaaatgtgatggaggctaaggttgtggtgagttcttgcgggcatgatggacct
tttgaagctactggagtcaagagattgaagagtatagggatgattgatagcgtccctgga
atgaaggcactggatatgaatgctgcagaagatgcaattgtcaggcttaccagggagatt
gtgcccggtatgattgttacaggaatggaagttgcagagatcgatggaggcccaagaatg
ggtccaacatttggagcaatgatgatatcagggcagaaggcagcacatttagccttgaag
gcattggggcagcctaatgtaatagatgggaccttcagcgaagctgaaagggtacagcca
gagtttgttcttgctgctgctgagacagaggggacggtgggtgcttga

DBGET integrated database retrieval system