KEGG   Endosymbiont of Acanthamoeba sp. UWC8: I862_02040Help
Entry
I862_02040        CDS       T03255                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K01598  phosphopantothenoylcysteine decarboxylase [EC:4.1.1.36]
Organism
eaa  Endosymbiont of Acanthamoeba sp. UWC8
Pathway
eaa00770  Pantothenate and CoA biosynthesis
eaa01100  Metabolic pathways
Module
eaa_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:eaa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    I862_02040
Enzymes [BR:eaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     I862_02040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein DrsE
Motif
Other DBs
NCBI-ProteinID: AIF80971
UniProt: A0A075MHS4
Position
complement(423696..423965)
Genome map
AA seq 89 aa AA seqDB search
MAKLLVIITGSIAAYKSIDLVRELEKKGHEISIILTESAKHFVSPLTYSSLTKAIIYNDY
VFEDSHYNPMLHIELAKNHELVLVVPAIL
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atggccaaattactggtaataatcacaggaagcatagcagcttataaaagtattgattta
gttagagaattagagaaaaaagggcatgagatcagcattatattaactgaatcggcaaag
catttcgttagcccgcttacctattcttcattaactaaagctattatttataatgattac
gtatttgaagattcgcattataatcctatgcttcatatagagttagctaaaaaccacgaa
cttgttttagtagtgccggcaattctttaa

DBGET integrated database retrieval system