KEGG   Endosymbiont of Acanthamoeba sp. UWC8: I862_03365Help
Entry
I862_03365        CDS       T03255                                 

Definition
(GenBank) methionyl-tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
eaa  Endosymbiont of Acanthamoeba sp. UWC8
Pathway
eaa00450  Selenocompound metabolism
eaa00970  Aminoacyl-tRNA biosynthesis
eaa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eaa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    I862_03365
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    I862_03365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eaa01007]
    I862_03365
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eaa03016]
    I862_03365
Enzymes [BR:eaa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     I862_03365
Amino acid related enzymes [BR:eaa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   I862_03365
Transfer RNA biogenesis [BR:eaa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    I862_03365
 Prokaryotic type
   Other AARSs
    I862_03365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AIF81233
UniProt: A0A075MJ76
Position
complement(687419..688921)
Genome map
AA seq 500 aa AA seqDB search
MSVKPKFYITTPIYYVNDIPHIGHAYTSLACDILARFKRLDGFDVMFLTGTDEHGQKIEK
SAVKAGKDPQAFTDKVYVSFKNLSQTMNFSNDDFIRTSEERHKKYVAEIWQRLVDSGNIY
LGKYSGWYAVRDEAFYSESELVDGKAPTGADVEWLEEPSYFFKLSAWQDKLLKLYEESPN
FIAPPSRRNEVISFVKSGLTDLSVSRTSFKWGIPVPGDEQHVIYVWLDALFNYISALGGE
NSHYWPCDLHVVGKDILRFHAVYWPAFLMAAGIELPKKVFAHGWWTNEGVKISKSLGNTI
NPVNLVEEFGLDYVRYFMMKEVPFGNDGNYSRSSFISRVNADLANNIGNLSQRVLSFIYK
NCEMKVPYSSTLNDKDVEFLNFAYQTIDKIRKEIDQQGINHAIQFIIDLSAKANEYIDRE
APWNLRKTDVERMGSVLYTLAEVIRVIAILLQPIMPDASGKILDILNVKERSFNTLNKDF
ALKEGHEINEPFGVFPRLEG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtaaaacctaaattttacattactactccaatttattatgtaaatgatattcct
cacatcgggcatgcttacacatcgcttgcatgtgatatattagcaaggtttaaacgcctg
gacgggtttgatgttatgttcttgaccggcaccgatgaacatgggcaaaaaattgaaaaa
tccgcggtgaaagcaggcaaagacccgcaagcatttaccgataaggtctatgtaagcttt
aaaaatctttctcaaacaatgaatttttccaatgatgattttatcagaacctctgaagaa
aggcataaaaaatatgtagctgaaatttggcagagattagttgatagcggtaatatttat
ttaggtaaatattcaggatggtatgcagttcgtgacgaagctttttacagtgaatccgag
ctggttgacggcaaagcaccaactggagctgatgtggagtggttggaagagcccagctat
ttctttaaattatcggcttggcaggataagttgcttaaattatatgaagaaagcccgaat
tttattgcacctccttcaagaaggaatgaggtgatatcttttgtgaaatcaggcctcacc
gatttatcggtatcgagaacctcgtttaagtggggaataccggttccgggagatgagcag
catgtaatttatgtttggctggatgccttatttaattatatatcggcacttggaggagaa
aattcgcattattggccatgtgatttacatgtggtgggtaaagatattttaaggtttcat
gcggtttattggccggcatttttgatggctgccggaattgagctcccgaaaaaagttttt
gcgcatggttggtggactaacgaaggggttaaaatatcaaagtcattaggtaatactatt
aatcccgtgaacttggttgaagaattcggcttagattatgttcgttattttatgatgaag
gaggtgccgttcggtaatgacggtaattactcaagatcaagttttatcagcagagtaaat
gcggatctggctaataatatcggtaatttatcgcaaagagtgctctcctttatatataaa
aattgcgaaatgaaagtaccttattcttccacattaaacgataaggatgttgaattttta
aattttgcttatcagacaattgataagataagaaaagaaatcgatcaacagggcataaat
catgctatacaatttatcatagatttaagtgcaaaagctaacgaatatattgatcgcgag
gctccttggaatttaagaaaaaccgatgtagagagaatgggttcggtactatatacttta
gctgaagtaataagagtaattgcaattttattacaacctataatgcctgatgcttccggc
aaaattcttgatattctaaatgttaaagaaagaagctttaatactttaaacaaagacttt
gctttgaaagaaggccatgaaattaatgagccgttcggagtatttccgaggttggaaggt
taa

DBGET integrated database retrieval system