KEGG   Endosymbiont of Acanthamoeba sp. UWC8: I862_06985Help
Entry
I862_06985        CDS       T03255                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eaa  Endosymbiont of Acanthamoeba sp. UWC8
Pathway
eaa00071  Fatty acid degradation
eaa00072  Synthesis and degradation of ketone bodies
eaa00280  Valine, leucine and isoleucine degradation
eaa00310  Lysine degradation
eaa00362  Benzoate degradation
eaa00380  Tryptophan metabolism
eaa00620  Pyruvate metabolism
eaa00630  Glyoxylate and dicarboxylate metabolism
eaa00640  Propanoate metabolism
eaa00650  Butanoate metabolism
eaa00900  Terpenoid backbone biosynthesis
eaa01100  Metabolic pathways
eaa01110  Biosynthesis of secondary metabolites
eaa01120  Microbial metabolism in diverse environments
eaa01130  Biosynthesis of antibiotics
eaa01200  Carbon metabolism
eaa01212  Fatty acid metabolism
eaa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I862_06985
   00630 Glyoxylate and dicarboxylate metabolism
    I862_06985
   00640 Propanoate metabolism
    I862_06985
   00650 Butanoate metabolism
    I862_06985
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I862_06985
   00072 Synthesis and degradation of ketone bodies
    I862_06985
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I862_06985
   00310 Lysine degradation
    I862_06985
   00380 Tryptophan metabolism
    I862_06985
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I862_06985
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I862_06985
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I862_06985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eaa04147]
    I862_06985
Enzymes [BR:eaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I862_06985
Exosome [BR:eaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I862_06985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III HTH_7
Motif
Other DBs
NCBI-ProteinID: AIF81951
UniProt: A0A075MKI0
Position
1458693..1459862
Genome map
AA seq 389 aa AA seqDB search
MEVVIVSALRTAVGNFNGTLSSMPAHKMSEILIKKTLENTKVAPNEVSEVIMGQILTSGE
GQNPARQASIGSGLPYTTTAFTINQVCGSGLRAVALGYQAILTGQAKIVIAGGQENMSRA
PHAVHMRNGTKMGSAELTDLMIKDGLWDAFNNVHMGITAEKIAEQFNISREDQDKFSVNS
QNKAEAAQKAGKFKDEIVPLTIPSRKGDIVFDQDEFIRVGASYEALSGIRPAFKKDGTVT
AGNASGINDGAALLMLMSKEEAEKRGLKILAKIKDFAQAGVDPIIMGTGPIDASRKVLEK
CGWAVDDLDLIEANEAFAAQAICVNKSLKLDETKVNVNGGAIALGHPIGASGARVLVTLI
HEMNKRDAKKGLATLCIGGGMGVAMCIER
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggtaatagttagcgcactaaggacggcagtaggaaattttaacggaacctta
agctcaatgcctgcgcataagatgtcagaaatattaattaaaaaaactttagaaaatact
aaagtagccccaaatgaggtgagcgaagttataatgggacagattctaacctcaggtgaa
ggacaaaatcctgcaaggcaagcctcgataggaagcggtttaccgtatacgacaactgcc
ttcacaattaatcaagtatgcggttcaggcctaagagcagtagcattagggtatcaagca
atcctaaccggacaagctaaaatagtaattgccggtgggcaggaaaatatgagccgtgcg
cctcatgcagtgcatatgagaaacggaactaaaatgggttcggcagaactaaccgatctt
atgattaaagacgggttatgggatgcatttaataatgtacatatgggtataacggcagaa
aaaattgccgagcaatttaatatcagcagagaagatcaggataaattctcggttaattcg
caaaataaagcggaagccgctcaaaaagcaggtaagtttaaagatgaaatagtacccctt
actataccttccagaaaaggcgatatagtctttgatcaagatgaatttattcgtgtagga
gccagctacgaagctttatcaggaattagaccggcatttaaaaaagacggcacggtaact
gccggtaatgcttcaggtattaatgacggggcagcacttttaatgcttatgagcaaagaa
gaagcagaaaaaagaggcctaaaaatactggcaaaaattaaggactttgcccaagcaggg
gtggatcctatcattatgggaacagggccgatagatgcgtcacgaaaagtattggaaaaa
tgcggttgggcagtagatgaccttgaccttattgaagctaatgaggcgtttgcagcgcaa
gcaatatgcgtcaacaaaagcttaaaattagatgagactaaagtgaatgtgaacggcgga
gcaattgcattaggccatccgatcggtgcatcaggcgcaagagttttagtaacccttatt
catgaaatgaataaaagagatgcgaaaaagggcttagccactctttgcatcggtggtggt
atgggtgttgctatgtgtatagaaagataa

DBGET integrated database retrieval system