KEGG   Escherichia coli ABU 83972: ECABU_c15410Help
Entry
ECABU_c15410      CDS       T01995                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eab  Escherichia coli ABU 83972
Pathway
eab00260  Glycine, serine and threonine metabolism
eab00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eab01100  Metabolic pathways
eab01110  Biosynthesis of secondary metabolites
eab01130  Biosynthesis of antibiotics
eab01230  Biosynthesis of amino acids
Module
eab_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECABU_c15410 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECABU_c15410 (trpA)
Enzymes [BR:eab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECABU_c15410 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADN46094
Structure
PDB: 

Position
complement(1521076..1521882)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAECEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcaccctcggtgatccgggcattgagcagtcgttgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggagttaggcatccccttctccgacccactggcggat
ggcccgacgattcaaaacgccacactgcgtgcttttgcggcgggagtaaccccggcgcag
tgctttgagatgctggcactcattcgccagaagcacccgaccattcccatcggccttttg
atgtatgccaacctggtgtttaacaaaggcattgatgagttttatgccgagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgcccgtggaagagtccgcgcccttccgc
caggccgcgttgcgtcataatgtcgcacctatctttatttgcccgccgaatgccgacgat
gatttgctgcgccagatagcctcttacggtcgtggttacacctatttgctgtcgcgagcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgctgcgcctccattgcagggatttggtatttccgccccggatcaggta
aaagccgcgattgatgcaggagctgcgggcgcgatttctggttcggccatcgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagcttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system