KEGG   Escherichia coli ABU 83972: ECABU_c15460Help
Entry
ECABU_c15460      CDS       T01995                                 

Gene name
trpH
Definition
(GenBank) putative phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
eab  Escherichia coli ABU 83972
Brite
KEGG Orthology (KO) [BR:eab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECABU_c15460 (trpH)
Enzymes [BR:eab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     ECABU_c15460 (trpH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ADN46099
Position
1527880..1528761
Genome map
AA seq 293 aa AA seqDB search
MSDTNYAVIYDLHSHTTASDGCLTPEALVHRAVEMRVGTLAITDHDTTAAIAPAREEISR
SGLALNLIPGVEISTVWENHEIHIVGLNIDITHPLMCEFLAQQTERRNQRAQLIAERLEK
AQIPGALEGAQRLAQGGAVTRGHFARFLVECGKASSMADVFKKYLARGKTGYVPPQWCTI
EQSIDVIHHSGGKAVLAHPGRYNLSAKWLKRLVAHFAEHHGDAMEVAQCQQSPNERTQLA
TLARQHHLWASQGSDFHQPCPWIELGRKLWLPAGVEGVWQLWEQPQNTTEREL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgacacgaattacgcagtgatttacgacctgcacagccataccacagcttccgat
ggctgcctgacgccagaagcattggtgcaccgtgcagtcgagatgcgcgtcggcaccctg
gcgatcaccgaccatgacaccacagctgcaattgcaccagcaagagaggaaatttcacgt
tcgggactggcgctgaatcttattcctggtgtggaaatttccacggtctgggaaaatcat
gaaattcatattgtcgggctgaatattgatattactcatccgctaatgtgtgagttcctc
gcgcagcagacagaacggcgcaatcagcgggcgcagctgattgccgaaagacttgaaaaa
gcgcaaatacctggggcactggaaggcgcgcaacgactggcgcagggcggtgcggtgacg
cgcggtcattttgcgcgtttccttgtggagtgcggaaaagccagttcaatggcggatgtc
tttaaaaagtatctggcgcgcgggaaaaccggatacgttccgccacagtggtgtacaata
gagcaatctattgatgtcattcatcattctggcggtaaggcggtgctagcccatcctggg
cggtacaatcttagtgctaaatggctgaaaagattggttgcgcattttgccgaacaccac
ggcgacgcgatggaagtcgcgcagtgccagcaatcgcccaatgaacgcacccagctggcg
acacttgcgcgtcagcatcatttatgggcatcacaaggatctgattttcatcagccatgc
ccgtggatcgaactgggtcgtaaactctggctgcccgcaggcgttgaaggcgtctggcag
ctatgggaacagccgcagaacaccacagagagggaattatga

DBGET integrated database retrieval system