KEGG   Escherichia coli ABU 83972: ECABU_c30880
Entry
ECABU_c30880      CDS       T01995                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
eab  Escherichia coli ABU 83972
Brite
KEGG Orthology (KO) [BR:eab00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eab02044]
    ECABU_c30880
Secretion system [BR:eab02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECABU_c30880
SSDB
Motif
Pfam: T6SS_VipA GerD Imm65
Other DBs
NCBI-ProteinID: ADN47561
Position
3145080..3145580
AA seq 166 aa
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKVDINK
NNFNSVMAEFSPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMR
NLLRDLKSNLLDNATFRRELENILKDPTLSSELRDELAKIAPQENV
NT seq 501 nt   +upstreamnt  +downstreamnt
atggccgacagtttccagaatgaagttcccgccgctcgtgtaaatatcaagcttgatctg
catacaggcaatgctaaaaagaaagttgaactccccctcaagcttcttgccgtaggcgat
tacagtaacggaaaagagcaacgtccgctgtccgaacgggacaaggttgatatcaataaa
aacaacttcaacagcgtcatggctgagttttcgcctgcggttaatttaacagtagaagat
acgctaaacggaaacggtaatgaacaaaatatcgcgcttgaatttaaaagcctgaaggat
tttgaacccgaacaggtagcaaaaaatattccgcaacttcgtgtattactcgctatgcgc
aatttactacgtgacctgaaatccaatctgctggataacgcaacgtttcgccgtgaactg
gaaaatatcctgaaagacccgacgctcagttcagaactgcgtgatgaactggcgaaaatt
gcgccgcaggagaacgtttaa

DBGET integrated database retrieval system