KEGG   Escherichia coli ABU 83972: ECABU_c30890
Entry
ECABU_c30890      CDS       T01995                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
eab  Escherichia coli ABU 83972
Brite
KEGG Orthology (KO) [BR:eab00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eab02044]
    ECABU_c30890
Secretion system [BR:eab02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECABU_c30890
SSDB
Motif
Pfam: VipB VipB_2 P2_N
Other DBs
NCBI-ProteinID: ADN47562
Position
3145639..3147177
AA seq 512 aa
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERV
TAAIHVLLSCLAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGT
WFVVQRTDFRKNVRIELLDISKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASL
ISSYEFDNSPQDIALLRNISRVSAASHMPFIGSVGPKFFLKNSMEEVAAIKDIGNYFDRA
EYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHEKYLWTNAS
FAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSEVMIPETREFE
FANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPG
FFRVRLFAVPHFQIEGMDVNLSLVSQMPKAKA
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtctgtacaacaagaacatgccacctctgaaactgcaacactcaccaccactgagtcc
ggcggcgtttatcagtccctgttcgataaaattaatttaaccccggtgtcttccattcag
gaaatcgatttatggcaaaacagcgaaacgctggccgatgcctcacccgatgagcgcgtg
acggcggcgattcacgttctgctttcctgtctggcgaaatcaggcgaggacgtggttaag
ctcgacaagagcctgctggattttcatatcgacgatctggatcagaaaatcagtaaacag
cttgatgcggtcatgcaccaccctgaattccagaaagtcgagtcgctgtggcgtggtaca
tggttcgtcgtacagcgcactgattttcgcaaaaatgtcagaattgaattgctggatatc
agcaaagagcatctgcgtcaggattttgatgattcaccggaaatcattcagagtggttta
tatcgccatacatacattcaggagtacgatacgccgggtggcgaacctgtagcctcatta
atatccagctatgaatttgataacagcccgcaggatattgccctgctgcgtaatatttcc
agagtgtctgccgcttcccatatgccttttatcggttctgtcggaccgaaattcttcctt
aaaaattcgatggaagaagtcgccgcgattaaagatatcggcaactactttgaccgcgca
gaatatattaaatggaagtcgttccgcgatacggatgacagccgctatgtgggattagtg
atgccgcgcgtgctgggccgtctgccctatgggccggacacggtgccggtacgcagcttt
aactatgtggaagaagtcaaaggcccggatcacgaaaaatacctgtggacaaacgcctcg
ttcgcctttgccgccaatatggtgaagagctttgtgaataatggctggtgcgtgcagatc
cgtggcccacaggcgggcggcgcagtggccgatctgccgatccatctttacgatctcggc
accggcaatcaggtcaaaattccgtccgaagtgatgatcccggaaacccgcgagtttgag
ttcgccaaccttggctttattccactctcttattacaaaaaccgcgattacgcctgcttt
ttctcggcaaactccgcccagaaaccggcgctgtatgataccgctgacgccaccgccaac
agccgtatcaacgcccgtttgccctatatcttcctgctgtcccgcattgctcactacctg
aaaattattcagcgcgagaatatcggcaccaccaaagaccgccgcgtgctggaactggag
cttaacacctggatccgcacgctggtgacggaaatgaccgatccgggcgatgaacttcag
gcttcgcatccactgcgcgacgggaaagttatcgtcgaggacatagaggacaatccgggc
tttttccgcgtcagactctttgccgtgccgcatttccagatcgaagggatggacgtcaac
ctttctctggtttcccagatgccaaaagcaaaagcctga

DBGET integrated database retrieval system