KEGG   Escherichia coli ABU 83972: ECABU_c31490
Entry
ECABU_c31490      CDS       T01995                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
eab  Escherichia coli ABU 83972
Pathway
eab00230  Purine metabolism
eab01100  Metabolic pathways
eab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECABU_c31490 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ADN47620
Position
3221278..3221757
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLATWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcgccaggaatgccgctttcggaactactccgagaacaagggcttcttagtgtc
aaacaaggttgctgcgtaggcgaatgcggtgcctgtacggtgctggtcgacggcactgcg
atagacagttgcttattccttgcgacctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggtaaactttctcatgtccaactggcttatgcgaaatctggtgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcgatgctggcaaaa
ccacgcgaaaaaccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system