KEGG   Escherichia coli ABU 83972: ECABU_c42840Help
Entry
ECABU_c42840      CDS       T01995                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eab  Escherichia coli ABU 83972
Pathway
eab00860  Porphyrin and chlorophyll metabolism
eab01100  Metabolic pathways
eab01110  Biosynthesis of secondary metabolites
eab01120  Microbial metabolism in diverse environments
Module
eab_M00121  Heme biosynthesis, glutamate => heme
eab_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECABU_c42840 (hemD)
Enzymes [BR:eab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ECABU_c42840 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 GATase_4
Motif
Other DBs
NCBI-ProteinID: ADN48703
Position
complement(4358119..4358859)
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPFPAGEELVSRLRTLGQVAWHFPLIEFSPGRQLPQLADQLAALGESDLLFALS
QHAVAFAQSQLHQQDRKWPRLPDYFAIGRTTALALHTVSGQKILYPQDREISEVLLQLPE
LQNIAGKRALILRGNGGRELIGDSLTARGAEVTFCECYQRCAIHYDGAEEAMRWQSREVT
TVVVTSGEMLQQLWSLIPQWYREHWLLRCRLLVVSERLAKLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctggtcacccgcccgtttcccgcaggagaagagttagtgagccgtctgcgc
acactggggcaggtggcatggcattttccgctgattgagttttctccgggtcgacaatta
ccgcaacttgctgatcaactggcagcgctgggagagagcgatctgttgtttgccctctcg
caacacgcggttgcttttgcccaatcacagctgcatcagcaagatcgtaaatggccccga
ctacctgattatttcgccattggacgcaccaccgcgctggcactacataccgtaagcgga
cagaagattctctacccgcaggatcgggaaatcagcgaagtcttgctacaattacctgaa
ttacaaaatattgcgggcaaacgtgcgctgatattacgtggcaatggcggtcgtgagcta
attggggattccctgacggcgcgcggtgctgaggtcactttttgtgaatgttatcaacga
tgcgcaatccattacgatggtgcagaagaagcgatgcgctggcaatcccgcgaggtgacg
acggtcgttgttaccagcggtgaaatgttgcagcaactctggtcgctgatcccacaatgg
tatcgtgagcactggttactacgctgtcgactattggtcgtcagtgagcgtttggcgaaa
ctcgcccgggaactgggctggcaagacattaaggtcgccgataacgctgacaacgatgcg
cttttacgggcattacaataa

DBGET integrated database retrieval system