KEGG   Escherichia coli ABU 83972: ECABU_c45870Help
Entry
ECABU_c45870      CDS       T01995                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eab  Escherichia coli ABU 83972
Pathway
eab00020  Citrate cycle (TCA cycle)
eab00310  Lysine degradation
eab01100  Metabolic pathways
eab01110  Biosynthesis of secondary metabolites
eab01120  Microbial metabolism in diverse environments
eab01130  Biosynthesis of antibiotics
eab01200  Carbon metabolism
Module
eab_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eab_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eab00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECABU_c45870
  Amino acid metabolism
   00310 Lysine degradation
    ECABU_c45870
Enzymes [BR:eab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ECABU_c45870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H DUF4331
Motif
Other DBs
NCBI-ProteinID: ADN48982
Position
4679840..4680994
Genome map
AA seq 384 aa AA seqDB search
MIEITVPVLPESVTEGTLTTWCKQEGEHVKRDDVIAELETDKVILEIPAPHDGVLSNIIV
SEGSTVTSAQLLAHLKPQAVIEETVTPVTETLAMPSARLEAQRSGVELADVAGSGRNGRI
LKEDVQRVTPAPVIQPERVAEIAPAKPLTPGARQERREPMSRLRQRIAERLLASQQNNAI
LTTFNEVNMQSVMDLRARWKDRFAEKHGVKLGFMSFFVKAVTRALERFPVVNASVDGNEI
IWRDYCDIGIAVSSNRGLVVPVLRNAQSLSLVEIERQIAEYATQARNGKLPLEALQGGTF
SITNGGTFGSMMSTPIINPPQSAILGMHAITPRPVAENGQVVIRPMMYLALSYDHRIIDG
QEAVQTLVAIRELLESPEQLLLDL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattactgtccctgtattaccggaatctgtcacggaaggcacgctgacaacc
tggtgtaaacaagaaggcgagcacgtaaaacgcgatgatgtgattgccgagctggaaacc
gataaagtcattctggaaataccggccccgcacgatggcgtgttaagcaatattatcgtc
agcgaaggtagcacggtcacgtccgcgcaactgttggcgcatcttaagccgcaagctgtc
atagaagaaaccgtcacaccagtcaccgaaaccctggcgatgccttccgcacggctggag
gcacagcgtagtggtgtcgaacttgctgacgttgcggggagcgggagaaatggacgtatc
ctgaaagaggatgtacagcgcgttactcctgcaccagtcattcagcctgaacgggtggcg
gagatcgcgccagctaaacccttgacaccgggtgctcgtcaggaacgtcgtgagccgatg
tcgcgcttacgtcagcggattgctgagcgtctgctggcttcccaacaaaataacgccatt
cttaccacattcaacgaagtaaacatgcagagcgtgatggatttacgcgcccgctggaaa
gatcgttttgccgagaagcacggcgtgaagctgggctttatgtccttctttgttaaggcc
gttacccgggcgctggagcgcttccctgtagtgaatgccagcgttgatggcaacgagatt
atctggcgtgattattgcgatatcggcattgcagtgagcagcaaccgcggcctggtagtg
cctgtgttacgcaatgcgcaatcactctctttggtggaaattgaacggcaaattgccgaa
tacgccacacaggcacgcaatggcaaattgccgctggaggcgttacagggcggcacgttc
tctatcaccaacggcggtacttttggttcgatgatgtcaacgccaatcattaacccgccg
cagtcggccattcttgggatgcatgccatcacgccgcgcccggtcgcagaaaacggccag
gttgttattcgtcccatgatgtaccttgctctcagctatgaccatcgcattatcgatggt
caggaagccgtgcagacattggtggcaatacgtgagctactggaatcaccggaacaactg
ttgctggatctttaa

DBGET integrated database retrieval system