KEGG   Escherichia coli ABU 83972: ECABU_c50250Help
Entry
ECABU_c50250      CDS       T01995                                 

Gene name
nadR
Definition
(GenBank) bifunctional DNA-binding transcriptional repressor and NMN adenylyltransferase
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
eab  Escherichia coli ABU 83972
Pathway
eab00760  Nicotinate and nicotinamide metabolism
eab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECABU_c50250 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eab03000]
    ECABU_c50250 (nadR)
Enzymes [BR:eab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     ECABU_c50250 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     ECABU_c50250 (nadR)
Transcription factors [BR:eab03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    ECABU_c50250 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 Citrate_ly_lig HTH_26 CTP_transf_like MMR_HSR1 FAD_syn HTH_37 ABC_tran AAA_29 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ADN49398
Position
5116665..5117897
Genome map
AA seq 410 aa AA seqDB search
MSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFP
RQKKTIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGFDDTRDRALFEDSAMSQQPTV
PDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKKFMAEKGIQPDLIYTSEE
ADAPQYMEHLGIETVLVDPKRTFMSISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SSVDRKEFQNLLVEMLEENNIEFVRVEEDDYDSRFLRCVELVREMMGEQR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcatttgattacctgaaaactgccattaagcaacagggctgcacgctacagcag
gtagctgatgccagcggtatgaccaaagggtatttaagccagttactgaatgccaaaatt
aaaagccccagcgcgcaaaaactggaggcattgcaccgttttttggggcttgagtttccc
cggcagaagaaaacgatcggtgtcgtattcggtaagttttacccgctgcatactggacat
atctaccttatccagcgcgcctgtagccaggttgacgagctgcatatcattatgggtttt
gacgatacccgcgaccgcgcattgttcgaagacagcgccatgtcgcagcagccaaccgtg
ccggatcgtctgcgctggttattgcagacctttaagtatcaaaaaaatatccgcattcat
gcttttaacgaagagggcatggaaccgtatccacatggctgggatgtgtggagcaacggc
atcaaaaagtttatggccgaaaaaggcattcagccggacctgatctacacctcggaagaa
gccgatgcgccgcagtatatggaacatctggggatcgagacggtgctggtcgatccgaag
cgtacctttatgagtatcagcggtgcgcagatccgcgaaaacccgttccgctactgggaa
tatattcctacggaagttaagccgttctttgtgcgtaccgtggcgatccttggcggcgag
tcgagcggtaaatccaccctggtaaacaaacttgccaatatcttcaacactaccagtgca
tgggaatatggtcgcgattatgtcttttcacaccttggcggtgatgagattgcgttgcag
tattccgactacgataaaatcgcgctgggacacgcgcaatatattgattttgcagtgaaa
tatgccaataaagtggcgtttatcgacaccgattttgtcactacccaggcgttctgcaaa
aagtacgaagggcgtgagcatccgttcgtgcaggcgttgattgatgaataccgtttcgat
ctggtgatcctgctggagaacaacacgccgtgggtggcggatggtttacgcagcctcggc
agttcggtggatcgcaaagagttccagaacttgctggtggagatgctggaagagaacaat
atcgaattcgtgcgggttgaagaggacgattacgacagccgtttcctgcgctgcgtggag
ctggtgcgggagatgatgggggagcaaagataa

DBGET integrated database retrieval system