KEGG   Peptoclostridium acidaminophilum: EAL2_808p00960Help
Entry
EAL2_808p00960    CDS       T03061                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
eac  Peptoclostridium acidaminophilum
Pathway
eac00860  Porphyrin and chlorophyll metabolism
eac01100  Metabolic pathways
Module
eac_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:eac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EAL2_808p00960
Enzymes [BR:eac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     EAL2_808p00960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AHM57602
UniProt: W8TN39
Position
EAL2_808p:96029..96631
Genome map
AA seq 200 aa AA seqDB search
MRLILVRHVQTVANAENRIYGRLDSDFTGEGLAQLEWLRRELAHERVDAVFSSPMSRALS
VAKEMSKTLQLGTETIQVRDELSEMDFGIFEGLTYEEAMQRHPVEWESYCESCMEYKIPG
GESFAEFERRIGEFIESLEDDDSTVLIVTHGGVVQSIMTRLLGFASEQRWHFRVRPASIV
EIETAQGYGILNRLIWPREE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagactcatattggtaaggcatgtgcagactgtggcaaatgcggaaaacaggatatac
ggcaggcttgactcggatttcacaggggagggcctggctcagctcgaatggctaaggcgc
gagcttgcgcacgaacgagttgatgcagtgttttcaagtcccatgtcaagggcgctttca
gtagctaaggagatgagcaaaaccttgcagcttggaactgaaaccatacaggtcagagac
gagctttcagagatggattttgggatttttgagggcttaacatacgaagaggcgatgcag
aggcatccggtagagtgggagagctactgcgaaagctgcatggaatacaagataccggga
ggagagagctttgccgaattcgagcgcagaatcggagaatttattgaatcactagaggat
gacgactctactgtactcattgtgacgcacggaggagtcgtgcagagcattatgacgagg
ctgctcggttttgccagtgagcagaggtggcatttcagggtgaggccggcgagcattgtt
gaaatagagactgcgcagggttacgggatactaaacaggctgatatggccgcgggaggaa
taa

DBGET integrated database retrieval system