KEGG   Peptoclostridium acidaminophilum: EAL2_c17980Help
Entry
EAL2_c17980       CDS       T03061                                 

Gene name
murI
Definition
(GenBank) glutamate racemase MurI
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
eac  Peptoclostridium acidaminophilum
Pathway
eac00471  D-Glutamine and D-glutamate metabolism
eac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EAL2_c17980 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eac01011]
    EAL2_c17980 (murI)
Enzymes [BR:eac01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     EAL2_c17980 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:eac01011]
 Precursor biosynthesis
  Racemase
   EAL2_c17980 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Peripla_BP_1 DUF3865 DHDPS
Motif
Other DBs
NCBI-ProteinID: AHM57090
UniProt: W8T888
Position
complement(1812607..1813413)
Genome map
AA seq 268 aa AA seqDB search
MKESPIGVFDSGIGGLTVLKEIMNVLPNENIVYFGDTARVPYGSRSAETVTKYAFQSINF
LLEKGVKAIVIACNTATARSLSIVQQKYDIPIVGVIKAGVRTAMELTSSGVVGVIGTEGT
VGSRAYELEMKSISSRVQVKGKACPLFVPIVEEGWHDTDVAEIIAHRYLDELREDGIDSL
VLGCTHYPLLTDTIQRVVGEAVKIVNPAKETAMDLMDTLQKHKLLNERGAQPSYEYYVSD
NPEKFSQVGEKFLNRAIDGIKLVEIQKY
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaaagtcccataggagtttttgattcgggtattggagggctaacagtactcaag
gagataatgaatgttttgccaaatgagaatatagtctattttggagacacggccagagtt
ccatatggctcgagatctgctgaaacagttacaaagtatgcgttccagtcgataaatttt
ctgcttgaaaagggcgtcaaggccatagtgatagcctgcaacacggcgacggccagaagc
ctttcgatagtgcagcaaaaatacgacattcccatagttggtgtaataaaggccggcgtg
agaacggcaatggagcttacaagcagcggggtcgtgggagtcataggtacggaaggaact
gttggttcgagggcttatgagcttgagatgaagagtatatcgagcagagtgcaggtgaaa
ggaaaggcttgtccgctgtttgtgccgatagttgaggagggctggcacgatactgatgtt
gccgagattatagcccacagatatctggatgagctcagagaagacggcatagattcactt
gttctgggctgcacgcactaccctttgcttacagatacaatacaaagggtggtaggcgag
gcggtcaaaatagtaaaccctgccaaggagactgccatggacctaatggacacactccaa
aagcacaaactgctcaatgaaagaggagcgcagccatcatacgagtattacgtttctgat
aatccggaaaagttttcccaggttggagagaagttcctcaacagggccatagatggcata
aaacttgttgaaatacaaaaatattaa

DBGET integrated database retrieval system