KEGG   Ensifer adhaerens OV14: OV14_1823Help
Entry
OV14_1823         CDS       T03054                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ead  Ensifer adhaerens OV14
Pathway
ead00071  Fatty acid degradation
ead00072  Synthesis and degradation of ketone bodies
ead00280  Valine, leucine and isoleucine degradation
ead00310  Lysine degradation
ead00362  Benzoate degradation
ead00380  Tryptophan metabolism
ead00620  Pyruvate metabolism
ead00630  Glyoxylate and dicarboxylate metabolism
ead00640  Propanoate metabolism
ead00650  Butanoate metabolism
ead00900  Terpenoid backbone biosynthesis
ead01100  Metabolic pathways
ead01110  Biosynthesis of secondary metabolites
ead01120  Microbial metabolism in diverse environments
ead01130  Biosynthesis of antibiotics
ead01200  Carbon metabolism
ead01212  Fatty acid metabolism
ead02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ead00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OV14_1823
   00630 Glyoxylate and dicarboxylate metabolism
    OV14_1823
   00640 Propanoate metabolism
    OV14_1823
   00650 Butanoate metabolism
    OV14_1823
  09103 Lipid metabolism
   00071 Fatty acid degradation
    OV14_1823
   00072 Synthesis and degradation of ketone bodies
    OV14_1823
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OV14_1823
   00310 Lysine degradation
    OV14_1823
   00380 Tryptophan metabolism
    OV14_1823
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OV14_1823
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OV14_1823
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    OV14_1823
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ead04147]
    OV14_1823
Enzymes [BR:ead01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OV14_1823
Exosome [BR:ead04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OV14_1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AHK43624
UniProt: W8I8Y9
Position
1:complement(1789514..1790632)
Genome map
AA seq 372 aa AA seqDB search
MRGVLAEVEPARLAAPLITRILADVGLAAEALDDVILGNAANCAGNLGRLAALEAGLPVS
TPGLTIDRQCGAGLEAITLAARLIQSGAGRFYLAGGTESASRAHIRLRPPTTPGEEPQPI
KRSRMAPDEIGDPDMGVAAENVATACSISRERQDAFALESQRRAVAAQGAGRFTREIVPI
ETTAGIVEADECPRANASLETLQRLKPVFVQDGTVTAGNACPINDGAAMVLVTSLAEARR
LGLSFALEFIDATTAGVHPDLLGLGPVPAMEKLKARNPALDVDAIDFIEFNEAFASQVLG
SLDQLDISPERVNLDGGAIALGHPYGASGAILVVRLFTQMLAVPRETQALAMMGIGGGMG
GVALFRSLRPTE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcggcgtgctcgcggaggtcgagccggcacggctcgctgcgccgttgatcacccgc
atcctcgccgatgtcggcctggcggcggaggcgctcgatgacgtcatcctcggcaatgcc
gccaactgcgccggcaaccttggacggctggcggcacttgaggccggacttccggtatcg
acacccggcctgaccattgaccggcagtgcggcgccgggctcgaggccatcacccttgcc
gcccgtctcatccagtcgggcgccggtcgcttctaccttgccggcggcaccgaaagcgcc
agtcgcgcccatattcgcctgaggccgccgacgacccctggcgaagagcctcaaccgatc
aagcgttcgcgcatggcaccggacgagatcggtgaccctgacatgggcgttgccgccgaa
aacgtcgccacagcctgcagcatttcccgcgaaagacaggatgcgtttgcgctcgaaagc
cagcgacgcgccgtcgccgcccagggcgcgggccggtttacgcgcgagatcgtaccgatc
gaaacgactgcggggatcgtcgaggccgacgaatgcccgcgcgccaatgcatcgctcgaa
accctgcagcggctgaaacccgtcttcgtccaggacggcacggtgaccgccggaaatgcc
tgcccgatcaacgacggcgcagcgatggttctggtgaccagccttgccgaagcgcgacgc
ctggggctttcctttgcgctcgaattcatcgatgcgacgaccgccggtgtgcatcccgat
ctgctcgggctcggcccggtgccggcgatggaaaaactgaaagcgcgcaatccggcgctt
gatgtcgatgcgattgatttcatcgaattcaacgaggccttcgcctcgcaggtgctcggc
agcctagatcaactcgatatttcgccggaacgggtcaatctcgacggcggtgccatcgcc
ctcggccatccctatggcgcatccggcgcgatcctcgtggtgcggctgttcacgcagatg
ctggcagtcccgcgcgaaacgcaggcactggcgatgatgggcatcggcggcggcatgggc
ggcgtcgcgctgttccgcagcctgcggcctaccgaatag

DBGET integrated database retrieval system